KEGG   Streptomyces puniciscabiei: BFF78_29750Help
Entry
BFF78_29750       CDS       T05140                                 

Definition
(GenBank) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00450  Selenocompound metabolism
spun00970  Aminoacyl-tRNA biosynthesis
spun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BFF78_29750
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BFF78_29750
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spun01007]
    BFF78_29750
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spun03016]
    BFF78_29750
Enzymes [BR:spun01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BFF78_29750
Amino acid related enzymes [BR:spun01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BFF78_29750
Transfer RNA biogenesis [BR:spun03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BFF78_29750
 Prokaryotic type
   Other AARSs
    BFF78_29750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f zf-C2H2_9
Motif
Other DBs
NCBI-ProteinID: AOR34678
UniProt: A0A1D7YGD0
Position
complement(6930388..6931950)
Genome map
AA seq 520 aa AA seqDB search
MSTTPSAKRYLIVPMHPTPNGRMHIGHAAGAYLRGDVIARHLRREGHDVSVISGTDAYEN
WIQLEALTAHRSPAETCWRYHSLIGDDLRSLGVELDQWVSPLDENHTGPYREVHEGLLRT
LAARGTAKKIADPVPRSKDSGRYVIGVWLQGTCPHCRTPGGGNACEECGYHYQPSEILQP
RSRLDEGPLVWQEFDSWYLSPPNVEEIIDRIRSADVAGDFADIAVAYLRQTGGRVRLSQP
GDWGIESELAGPDGVLSNPYFGFSLYCGELYRGLRNAAVNPFHRESDVTTVGLFGIDNAV
GGVGASHALALAHGELKPFDHMVTNYFLNFEGEKVSTSRKHGIWLNELLSRTSATADELR
YHLSHIALEKGSGNFTADGFAESVNRLRTRLADPLPGPASGEVPGEETERIVRTVAEQGR
HLQPGAALCLPSAVAVLDAWLEDRPARPGAGWLTGLALLAEPFMPTLAGDLWAGLGRLGR
PSLPALGRDTIGGRGAWPAPPAPLTAQELAGVSHVRSAHV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
gtgtccaccacaccatcggcgaagcggtacctgatcgtccccatgcacccgacacccaat
ggccgtatgcacatcggtcatgccgcgggcgcctacctgcgcggcgatgtgatcgcccgg
cacttacgccgtgaaggccacgacgtctcggtgatcagcggcaccgacgcgtacgagaac
tggatccagctggaggcgctgaccgcgcaccgcagtccggcggagacctgctggcgttac
cactcactgatcggagacgacctgcgcagtctcggtgtcgagctcgatcagtgggtctca
ccgctggacgagaatcacaccggcccgtaccgcgaagtccacgaagggcttctgaggacg
ctggccgcccggggcaccgcgaagaagatcgctgacccggttccccgctccaaggactcc
ggccgttacgtcatcggcgtctggctgcagggcacgtgcccgcactgccgtaccccgggc
gggggaaacgcctgcgaggagtgcggctaccactaccagccctcggagatccttcagccc
cggtcccggctcgacgaaggcccgctggtgtggcaggagttcgacagctggtacctcagc
ccgccgaacgtcgaggagatcatcgacaggatccggtcggccgacgtggccggtgacttc
gccgacatcgccgtcgcgtatctgcggcagaccgggggacgggtacggctgtcccagccg
ggcgactggggtatcgagagcgagctggcgggaccggacggcgtactgagcaacccctac
ttcgggttcagcctgtactgcggtgagctgtaccgcgggctccgcaacgccgcggtcaac
cccttccaccgggagtccgacgtgaccaccgtcggcctgttcgggatcgacaacgccgtg
ggcggggtgggcgcgagtcacgccctcgccctcgcccatggagagctgaagccgttcgac
cacatggtgacgaactacttcctcaacttcgagggggagaaggtctccaccagccgcaag
cacggcatctggctgaacgagctcctctcacggacgtcggcgaccgccgacgaactccgc
taccacctcagccacatcgctctggagaagggcagcgggaacttcaccgcggacggcttc
gccgagtccgtcaaccggctccgcacccgtctggcggacccgctccctgggcccgcctcc
ggcgaggtccccggcgaggaaaccgaacggatcgtccgtaccgtcgccgagcaggggcgg
catctgcagccgggagccgcgctctgcctgccctccgcggtggccgtgctcgacgcatgg
ctggaggaccgtcccgcgcggcccggagccggctggctgaccggactggccctgctggcc
gagcccttcatgcccacgctcgcgggggacctgtgggccggcctgggccggctcgggcgt
cccagcctgcccgcgctcggccgcgacaccatcggcgggcgcggcgcctggcccgcaccc
cccgcccccctgaccgcacaggaactggccggcgtcagccacgtgaggagcgcccatgtc
tga

DBGET integrated database retrieval system