KEGG   Streptomyces puniciscabiei: BFF78_36855Help
Entry
BFF78_36855       CDS       T05140                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
spun  Streptomyces puniciscabiei
Pathway
spun00260  Glycine, serine and threonine metabolism
spun01100  Metabolic pathways
spun01110  Biosynthesis of secondary metabolites
spun01120  Microbial metabolism in diverse environments
spun01130  Biosynthesis of antibiotics
spun01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:spun00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BFF78_36855
Enzymes [BR:spun01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BFF78_36855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Glyco_hydro_20
Motif
Other DBs
NCBI-ProteinID: AOR35894
UniProt: A0A1D7YK24
Position
8500399..8501469
Genome map
AA seq 356 aa AA seqDB search
MNPPKTDARRHHDPQVRGFASDNYAGAHPEVLAALALANGGHQVAYGEDEYTENLQRIIR
GHFGATAEAFPVFNGTGANVVALQAVTDRWGAVICAESAHINVDEGGAPERMGGLKLLTV
PTPDGKLTPELIDRQAWGWEDEHRAMPQVVSITQSTELGTLYTPDEIRAICEHAHARGMK
VHLDGSRIANAAASLNVPMRTFTNAVGVDILSLGGTKNGAVFGEAVVVINQDAVRQMKHL
RKLSMQLASKMRFVSVQLEALLAKDLWLRNARHANEMAQRLAEGVRAVHGVEILYPVQAN
GVFARLPHDVSERLQKRFRFYFWDEADGVVRWMCSFDTTEEDVDTFVAALKEEMAR
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccctcccaagaccgacgcgcgtcgccatcacgacccgcaggtccgcggtttcgcc
agtgacaactacgccggagcccacccggaggtgctggccgccctggccctggccaacggc
ggccaccaggtggcgtacggcgaggacgagtacaccgagaacctgcagcggatcatccgc
ggccacttcggggcgaccgcggaggccttcccggtcttcaacggcaccggcgccaacgtc
gtcgcgctccaggcggtcaccgaccgctggggcgcggtgatctgcgccgagagcgcgcac
atcaacgtcgacgagggcggcgcgcccgagcgcatgggcggcctgaagctgctcaccgtg
cccacgcccgacggcaagctcacgcccgagctgatcgaccggcaggcctggggctgggag
gacgagcaccgcgcgatgccgcaggtcgtctcgatcacccagagcacggagctgggcacc
ctctacacgccggacgagatccgggcgatctgcgagcacgcccacgcccggggcatgaag
gtgcacctggacggctcccggatagccaacgcggccgcttcgctgaacgtgccgatgcgg
acgttcaccaacgcggtcggcgtcgacatcctctcgctgggcgggaccaagaacggcgcc
gtcttcggtgaggcggtcgtggtcatcaaccaggacgcggtgcggcagatgaagcacctg
cggaagctgtccatgcagctcgcctccaagatgcggttcgtgtcggtgcagctggaggcg
ctgctggcgaaggacctgtggctgcgcaacgcccggcacgccaacgagatggcccagcgg
ctcgccgagggtgtgcgcgcggtgcacggcgtggagatcctctacccggtgcaggccaac
ggcgtcttcgccaggctcccgcacgacgtgagcgaacgtctgcagaagcggttccggttc
tacttctgggacgaggccgacggggtggtgcgctggatgtgctccttcgacaccacggag
gaggacgtcgacaccttcgtggcggcgctcaaggaggagatggcccgctag

DBGET integrated database retrieval system