KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_0507Help
Entry
SPH_0507          CDS       T00658                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv00051  Fructose and mannose metabolism
spv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPH_0507
Enzymes [BR:spv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     SPH_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UPF0052 UDPG_MGDP_dh_N Terminase_2
Motif
Other DBs
NCBI-ProteinID: ACA36431
UniProt: B1I9J3
Position
458963..460099
Genome map
AA seq 378 aa AA seqDB search
MKHSVHFGAGNIGRGFIGEILFKNGFHIDFVDVNNQIIHALNEKGKYEIEIAQKGQSRIE
VTNVAGINSKEHPEQVIEAIQKTDIITTAIGPNILPFIAELLAKGIEARRVAGNTQALDV
MACENMIGGSQFLYQEVKKYLSPEGLTFADNYIGFPNAAVDRIVPAQSHEDSLFVVVEPF
NEWVVETKRLKNPDLRLEDVHYEEDLEPFIERKLFSVNSGHATSAYIGAHYGAKTILEAL
QNPNIKSRIESVLAEIRSLLIAKWNFDKKELENYHKVIIERFENPFIVDEVSRVARTPIR
KLGYNERFIRPIRELKELSLSYKNLLKTVGYAFDYRDVNDEESIRLGELLAIQSVKDVVI
QVTGLDDQELIEQIVEYI
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattctgttcattttggtgccggtaatatcggtcgtggttttataggtgaaatt
ctatttaaaaatggtttccatattgattttgtggatgtcaataatcagataattcatgct
ctaaatgaaaagggcaagtatgaaattgaaattgcacagaaaggacagtctcgtatagaa
gtaactaatgtggctggcattaatagcaaagaacatcctgagcaagtcattgaagcgatt
caaaagacggatattattactactgcaatcggacctaatatactcccttttatcgccgaa
cttctagccaaaggaatcgaagctcgccgagttgcaggaaatacacaggcattggatgtt
atggcctgtgaaaatatgattggcgggtctcaatttctttatcaagaagtcaagaaatat
ttaagtccggaaggtttgacatttgctgataactacataggttttccaaatgctgcagta
gacaggattgttccagcacaaagtcacgaagattccctttttgttgtggtcgagcccttt
aatgaatgggtcgtggaaaccaagcgtcttaaaaatccagatttacgtctagaagatgtg
cattatgaagaagatttagaaccctttattgagcgaaaacttttttcagtcaattctgga
catgcaacttcagcttacattggtgcgcattatggtgccaagacaattttggaagctctt
caaaatcctaatatcaaatctcggattgaatctgtattagctgaaattcggagtctcttg
attgccaaatggaactttgataaaaaagaattggagaattatcacaaagtcattatagaa
cggtttgaaaatcctttcatagtggacgaggttagtcgcgtagctcgtactccaatccga
aaattaggctataatgaacgattcatccggccgatacgtgaattgaaagaactcagtttg
tcatataaaaacctacttaaaacagttggctatgcctttgactatcgcgatgtaaatgat
gaagaaagtattcgattaggtgaattgttggctatacaatcagtcaaagatgttgttata
caagttacaggtttagacgaccaagaattgattgagcaaattgtagagtatatttaa

DBGET integrated database retrieval system