KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1185Help
Entry
SPH_1185          CDS       T00658                                 

Definition
(GenBank) putative Probable cysteine desulfurase (NifS protein homolog)
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv00730  Thiamine metabolism
spv01100  Metabolic pathways
spv04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:spv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPH_1185
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SPH_1185
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spv03016]
    SPH_1185
   03029 Mitochondrial biogenesis [BR:spv03029]
    SPH_1185
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:spv02048]
    SPH_1185
Enzymes [BR:spv01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SPH_1185
Transfer RNA biogenesis [BR:spv03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SPH_1185
 Prokaryotic Type
    SPH_1185
Mitochondrial biogenesis [BR:spv03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SPH_1185
Prokaryotic defense system [BR:spv02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SPH_1185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP DUF3447
Motif
Other DBs
NCBI-ProteinID: ACA36107
UniProt: B1IBN3
Position
complement(1087538..1088653)
Genome map
AA seq 371 aa AA seqDB search
MIYLDNAATTPMSAVAISAMTKVMQETHGNPSSIHGHGRQAGKLLREARQELAQLLRTKP
QHIFFTSGGTEGNNTTIIGYCLRHQEQGKHIITTAIEHHAVLETIDYLVQHFGFEATIIQ
PENQEITAQQIQKALRDDTILVSTMFANNETGNLLPIAEIGQILKQHPAAYHVDAVQAIG
KIPIHSEELGIDFLTASAHKFHGPKGIGFLYASSMDFDSYLHGGDQEQKKRAGTENLPAI
VGMVAALKEDLEKQEEHFQHVQNLETAFLAELEGIQYYLNRGKHHLPYVLNIGFPGQKND
LLLLRLDLAGISISTGSACTAGVVQSSHVLEAMYGANSERLKESLRISLSPQNTVEDLQT
LAKTLKEIIGG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgatttatttggacaatgctgcaacgactcctatgtcagcagttgctatttcagctatg
accaaggttatgcaagaaacccacggaaatccttctagtattcatggtcatggtcgtcaa
gctggcaaactcttgcgagaagcccgtcaggaactagcccagttactaaggacaaaacct
caacatatctttttcacttctggtgggactgaaggcaataatactaccatcattggctac
tgtcttcgtcaccaagaacaaggaaaacatatcatcacaactgccatcgagcaccatgct
gtccttgaaacaattgattacttggttcaacactttgggtttgaagcaaccattatccag
ccagaaaatcaagaaatcacagcccagcaaattcaaaaggctttacgtgacgatacgatt
ttggtttctaccatgtttgccaataatgagacaggaaacctactgcccatcgctgaaatt
ggccaaatactcaagcaacaccctgctgcctatcatgttgatgcagttcaggctattggt
aaaatcccaattcattcagaagaattgggcattgattttctcactgcttctgcccacaaa
ttccatggtcctaagggaatcggttttctctacgcatctagcatggactttgattcctat
ctacatggcggagaccaggaacagaaaaaacgtgcaggaactgaaaatctgcctgctatc
gtaggcatggttgcagccctaaaagaagacctagaaaaacaagaagaacattttcaacat
gtacaaaatctagaaactgcctttctggcagagctggagggcattcagtattacttgaat
agaggaaaacatcatctcccttatgttctcaatattggatttcctggtcagaaaaatgac
ctcttactccttcggctagatttagctggaatttcaatctctactggctcagcctgtact
gcaggcgttgtccaatccagccatgttcttgaagccatgtatggcgcaaattcagaacgc
ttgaaggaatcccttcgcatcagtttgtcgccacaaaataccgttgaagacctacaaacc
ctcgcaaaaaccttaaaagaaattatcggaggttag

DBGET integrated database retrieval system