KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1403Help
Entry
SPH_1403          CDS       T00658                                 

Definition
(GenBank) conserved domain protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Tn916-Xis HTH_17 RelB_N RWP-RK
Motif
Other DBs
NCBI-ProteinID: ACA37419
UniProt: B1IC77
Position
complement(1303508..1303711)
Genome map
AA seq 67 aa AA seqDB search
MKQTDIPIWERYTLTIEEASKYFRIGENKLRRLAEENKNANWLIMNGNRIQIKRKQFEKI
IDTLDAI
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagactgacattcctatttgggaacgttataccctaaccattgaagaagcgtca
aaatattttcgtattggcgaaaacaagctacgacgcttggcagaggaaaataaaaatgca
aattggctgattatgaatggcaatcgtattcagattaaacgaaaacaatttgaaaaaatt
atagatacattggacgcaatctag

DBGET integrated database retrieval system