KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1411Help
Entry
SPH_1411          CDS       T00658                                 

Definition
(GenBank) conjugative transposon protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TpcC NuiA
Motif
Other DBs
NCBI-ProteinID: ACA37003
UniProt: B1IC85
Position
complement(1308321..1309238)
Genome map
AA seq 305 aa AA seqDB search
MMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTAIDTHTI
HETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQALNVDTV
RKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVYVDGSGN
MVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEINEFLTTFFKLYPTATASELSYYV
NDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQQTKATQVSQFDLVLEKNGSN
WKIIE
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatttagaaaaaatcagaataaagaaaaacagataccaaaggaaaagaaacct
cgtgtctactataaggtcaatcctcataaaaaggttgtgattgccttgtgggtactttta
gggcttagtttcagctttgcgatattcaagcactttacagctatagatactcatactatt
cacgaaacaactatcatagaaaaggaatacgttgatactcatcatgtagaaaattttgta
gagaactttgcgaaagtctactattcatgggagcaatccgataagtccattgataatcga
atggaaagtctaaaaggctatctgacagatgaacttcaagctctcaatgttgatacagta
cgcaaagatattcctgtatcgtcttctgtaagaggatttcagatatggacggtagagcca
actggcgacaatgagtttaatgtaacctacagtgtagaccagctcattacagagggagaa
aatacaaagaccgtccactctgcttatatagtgagtgtctatgtagatggttctggaaat
atggtactggttaagaatccgaccattaccaacatacctaagaaatcaagttataaacca
aaagccattgaaagtgaggggacggttgattccattacaaccaatgaaatcaatgagttt
ttaacgacgttcttcaagctctatcctacagcgacagccagtgaactttcctactatgtg
aatgacgggatattaaaaccaatcggaaaagagtacatctttcaagaactggtaaatcct
attcacaatcgtaaggataatcaagtcacggtatcgctgacagtggagtatatcgaccag
cagaccaaagcaacgcaggtatctcaatttgatttggtacttgaaaagaacgggagtaat
tggaagattatagaataa

DBGET integrated database retrieval system