KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1412
Entry
SPH_1412          CDS       T00658                                 
Name
(GenBank) NLP/P60 family protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
SSDB
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP
Other DBs
NCBI-ProteinID: ACA36364
UniProt: B1IC86
Position
complement(1309253..1310254)
AA seq 333 aa
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKY
AKEYGIEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLA
SSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIP
INGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKYEGWRYVYGGASPTTSFDC
SGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVFFHSTYNAGSYITHVGIYLG
NNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaagttgaaaactttagtgattggtggttctggattattcttgatggtcttctcactg
cttctgtttgttgccattttattttcagatgaacaggacagcggaatttccaatattcat
tatggaggtgtgaatgtttccgcagaagtgctggctcataagcctatggtagaaaaatat
gccaaagaatatggcattgaagaatatgtcaacatacttcttgcgattatacaggtggaa
tcgggcggtactgcggaagatgttatgcagtcctcggaatccctcggtcttccacctaat
tcattgagtacagaagaatccattaagcaaggtgtgaagtatttcagtgaattattagcc
agtagcgaaaggctcagtgtagatttagaatcggttatccagtcctacaattatggtggt
ggtttcttagggtatgtggctaatcgtggaaataaatatacctttgaactggctcaaagt
ttctcaaaagagtattcaggtggcgaaaaagtgtcttaccccaatcccatagccatacct
atcaatgggggctggcgatacaactatggcaatatgttttatgtgcaactggtaacgcag
tatcttgtcacaacagagtttgatgatgatacggtacaagccatcatggacgaagcactg
aaatatgagggctggcgatacgtttacggtggagcttccccgactacttcttttgattgt
agcggactgacacaatggacgtatggaaaagctggaattaacttaccacgaaccgcacaa
cagcaatatgatgtgacccagcatatcccactatcggaagcacaagctggcgatttggtt
ttctttcattctacctataacgctggctcttatattactcatgttgggatataccttggc
aataaccgtatgtttcatgcaggcgacccaatcggttatgccgacttaacaagcccctac
tggcaacagcatttagtgggagcaggacgaatcaaacaatga

DBGET integrated database retrieval system