KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1413Help
Entry
SPH_1413          CDS       T00658                                 

Definition
(GenBank) conjugative transposon membrane protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbL YtxH
Motif
Other DBs
NCBI-ProteinID: ACA35787
UniProt: B1IC87
Position
complement(1310251..1312428)
Genome map
AA seq 725 aa AA seqDB search
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAILLLAMLGTVVQAAGLVDDTVNVANEYS
RYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQE
AYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRET
TKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNASLSLGTKIVMPHSDSQGKD
SVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLSTSPDSNNGEDREKIVAEEI
EDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIYAMFLPVSFI
LSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGS
AIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKE
QVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEM
EQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPK
VERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKK
VGKKP
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaccatcaatagtaaacagaataaaatcaaactggacgctgaaacgtctaggtaaa
gtggcaatgacagtggctttcacacttgtgattgccattcttcttttagccatgctggga
acggtggttcaagctgcgggcttggtagatgatacggtcaatgtggcaaatgaatacagc
cgatacccacttgaaaactatcaactggatttttatgtggataatagctggggctggctt
ccgtggaactggtcggacgggattggaaaacaggtcatgtatggactatatgccattacc
aattttatttggacaatcagtttgtatgtttccaatgcgacaggttacttagtacaggaa
gcctattccttagacttcatttccgctacagcagattccattggtaagaatatgcagacc
ttagctggtgtgagtgcaaacggattttcaacagagggtttctatgttggattcctctta
ctcttgattttggttcttggggtttatgttgcctatacgggactgataaagagagaaacc
acaaaggcaattcatgccattatgaattttgtgctggtgtttatcctatcggcttccttt
attgcctacgctcccgactacattaaaaaaatcaatgacttttcatcagacatcagtaat
gccagtttatcacttggcacgaagattgtcatgccccattccgatagtcaaggcaaggac
agcgtggacttaatcagagatagcctgttttccatacaggttcagcaaccgtggctactg
cttcaatacaacagttcagacattgaaagtatcggtattgaccgtgtggaaagcctgctc
tccaccagcccagattccaacaatggcgaagacagagaaaaaattgttgcggaagaaatt
gaagacagaagcaataccaatctaaccattacaaagaccattaaccgtttaggtacagtc
ttcttcctatttgtcttcaatattgggatttccatatttgtattcctattaacaggaatc
atgattttctcgcaggtactttttatcatctatgctatgtttctgcctgtgagctttatt
ttaagcatgattccatcatttgatggtatgtcaaaacgagccataacaaagctctttaat
accattttgacacgagctggaatcacattgattattacgacagcatttagtatttcaacc
atgctctataccttatcggctggttatccgttctttttgattgcttttctacagattgtg
acctttgcaggaatctacttcaagctgggcgatttaatgagtatgttttctctacagagt
aacgattctcaaagtgtgggaagtcgtgtgatgagaaaacctcgtatgcttatgcacgct
cacatgcaccgtctacagcggaaacttggacgttccatgactactctaggggctgggtct
gccattgttacaggtaaaaaaggacagtcgggttcggggagttctgcaaggacacaagca
gatcactcccgaccagacggaaaggaaaaatcaacacttggaaaacgtatcggtcaaacc
atcggtacagtagctgataccaaagacagaatggtagacactgctagtggtttgaaagaa
caggttaaagatttgccgaccaatgcaagatatgcagtatatcaaggaaaatccaaagta
aaagagaatgtccgtgatttaaccagtagtatttctcaaaccaaagcggacagagccagt
ggacgcaaggaacagcaggaacaaaggcgaaaaaccattgcgaagcgtcgctctgaaatg
gaacaggtcaaacagaaaaaacagcctgcttcttctgttcatgaaagaccgactacaaga
caagaacaatatcatgatgaacagacctcaaaacagtctaatattcagacttcatataag
gaatctcaacaagccaaacaagagcgtccagcagttaagtccgatttttcaagtccaaaa
gtggaacgccaaggcaataccgttcaagaaaaaaccgttcaaaagccagcaacttcaacc
actacagcagatagaacttcacaacgtccaatcacaaaagaacgtccgtctactgttcaa
agagtaccactacaaaatacaagaagtagaccaccaatcaaaaccgccaccattaagaaa
gtcggtaagaaaccatga

DBGET integrated database retrieval system