KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1414Help
Entry
SPH_1414          CDS       T00658                                 

Definition
(GenBank) conjugative transposon protein
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 TBCC_N
Motif
Other DBs
NCBI-ProteinID: ACA37348
UniProt: B1IC88
Position
complement(1312431..1314878)
Genome map
AA seq 815 aa AA seqDB search
MAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVHDSFRQLIAQNRDGKIHA
LQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMIGENQVNYRFFIGFKLLL
NDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILRFQKMEKLLENKISRRFK
IRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIKYYDLIKPTRCLVEEKQR
YLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFPIDTSMNVEIVANRKALS
TVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQSKESMYKLSYVVRVSAN
DLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKRYMNDYIQYVTSDFLAGL
GFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTNALASAFVGSLGGGKSFA
NNLIVYYAVLYGAQAVIVDPKAERGRWKETLSEISHEINIVTLTSDEKNKGLLDPYVIMK
NPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVRGLMKVIEELRVENTPLS
TSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADLVLPDKETSFEEYTTMEL
LSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKTLSMKLVRAGRAMNAGVY
FVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDPEDENNQKRLRDLENGQC
LISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atggcatatccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgt
tatgcttactatgagcttgttccttacaattactcatttctaagtccagaacagaaaata
caagtgcatgattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgct
ttacaaatcagtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtc
actggcaagctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaata
tccatgattggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctc
aacgatcaggagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgat
tttgtctatgatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaa
atcctgcgttttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaa
atccgcaggttagataaggacgacttcggctatctgattgaacacctttacggacagaca
ggcactgcctatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacg
ctgattaaatactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcga
tatttgaaaatccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagc
attgtcggagaactggacttcccgtcctctgaaatcttctactaccagcaacagcaattt
acattcccgattgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatct
actgtccgcaataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgat
aatgaaaccagctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaat
ttagaccaaagcaaggaatctatgtacaagctgtcttatgtggtaagggtatcagcaaat
gatcttgacgaactcaaacgtcgttgtaatgaagtgaaagatttttatgacgatttaagc
gtaaaactggtacgaccatttggggatatgctcggcttacatgaagaatttttacctgcc
agcaagcgttatatgaatgattatattcaatacgtgacctctgatttcctcgctggttta
ggttttggtgctactcaaatgctgggggaaaatgaggggatttatgttggctacagctta
gatactggacgcaatgtctatctgaaacctgctcttgccagtcaaggggttaagggttca
gtaaccaatgcgttagcgtcggcttttgttggttcgctgggtggtggtaaatcctttgcg
aataaccttatcgtctattatgcggtgctttatggggcacaagcagtgattgtagaccca
aaagcagaacgtggcagatggaaagaaaccttgtcagagatttcccatgaaatcaatatc
gtcactctgacttctgatgagaaaaacaaaggcttacttgacccttatgtgattatgaaa
aatcccaaagattctgaatcactggctattgatattctgacattccttacggggatttcc
tctcgtgatggggaacgcttcccaatccttagaaaagccattcgtgcagtaaccaatagt
gaagtacgagggttgatgaaagtgattgaggaattacgggttgagaatacgccactaagt
accagtatagccgaccatatcgaaagttttacagactatgactttgcacatttattattc
agtaatggttatgtggagcagtctatcagcttagaaaaacaactgaacattatacaggtt
gcggacttggtacttcccgacaaggaaacttcctttgaggaatataccactatggagctt
ttatccgttgctatgctgattgtcattagtacctttgctttagactttatccatacagac
cgaagcattttcaagattgtagatttagacgaagcatggagctttttacaggtagcacaa
ggaaaaacactatctatgaagctggttcgggctggtcgtgctatgaacgctggggtatat
ttcgtgacccaaaatacagacgacctcttagatgaaaaactgaaaaataacctcggctta
aaatttgcatttcgttccactgaccttaacgagattaaaaagaccttagccttttttggt
gtagacccagaggacgaaaacaatcagaagcgattgcgtgatttggaaaacgggcaatgc
cttatcagtgatttatatggtcgtgtcggtgtgatacagttccaccctgtatttgaagaa
ctgctccatgcctttgataccagaccacctgtgcgaaaagaggtgtaa

DBGET integrated database retrieval system