KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1538Help
Entry
SPH_1538          CDS       T00658                                 

Definition
(GenBank) HAD-superfamily subfamily IIA hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv00627  Aminobenzoate degradation
spv01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spv00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SPH_1538
Enzymes [BR:spv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SPH_1538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_like Hydrolase_6 HAD_2 Hydrolase Hydrolase_3
Motif
Other DBs
NCBI-ProteinID: ACA36175
UniProt: B1ICK7
Structure
PDB: 

Position
complement(1423553..1424326)
Genome map
AA seq 257 aa AA seqDB search
MKYKGYLIDLDGTIYKGKDRIPAGETFVHELQKRDIPYLFVTNNTTRTPESVKEMLTQNF
NIDTPLSTVYTATLATIDYMNDLGLEKTVYVVGEAGLKEAIKAAGYVEDKEKPAYVVVGL
DWQVDYEKFATATLAIQKGAHFIGTNPDLNIPTERGLLPGAGSLITLLEVATRVKPVYIG
KPNAIIMDKAVEHLGLEREELIMVGDNYLTDIRAGIDNGIPTLLVTTGFTKAEEVAGLPI
APTHVVSSLAEWDFDEN
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataaaggctatttaattgatttagacggaaccatttataaggggaaagaccga
atccctgctggagagacttttgttcatgaattgcaaaagcgggacattccctatctcttt
gtaaccaacaatacaacccgcactccagagagtgttaaggagatgttgactcagaatttt
aatatcgatacgcccctatcgactgtctacacagcgactttggcaaccatcgactatatg
aatgatttggggcttgaaaagaccgtctatgtcgtcggagaagcaggactcaaggaagcc
atcaaggcggctggttatgtggaagacaaggaaaaacctgcctacgtggtagttggtctg
gattggcaagtcgactatgaaaaatttgccacagcaactcttgctattcaaaagggtgcc
cattttatcggaaccaatcctgacctcaacatcccgacggaacgcggtcttttgccaggt
gctggctcactgattacgctgcttgaagtagcgacacgagtgaagccggtttatatcgga
aaaccaaatgccatcattatggacaaggcggttgagcacttaggtttggaacgtgaagag
ttaatcatggttggggacaattatttgactgatattcgggctgggattgacaatggcatt
ccaacgctcttggtgacgacaggttttactaaggcagaagaagtagctggcctgccaatc
gcaccgacacatgtggtttctagccttgcggagtgggattttgatgaaaactaa

DBGET integrated database retrieval system