KEGG   Streptococcus pneumoniae Hungary19A 6 (serotype 19A): SPH_1937Help
Entry
SPH_1937          CDS       T00658                                 

Gene name
trpD
Definition
(GenBank) anthranilate phosphoribosyltransferase
  KO
K00766  anthranilate phosphoribosyltransferase [EC:2.4.2.18]
Organism
spv  Streptococcus pneumoniae Hungary19A 6 (serotype 19A)
Pathway
spv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01230  Biosynthesis of amino acids
Module
spv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:spv00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPH_1937 (trpD)
Enzymes [BR:spv01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.18  anthranilate phosphoribosyltransferase
     SPH_1937 (trpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: ACA36850
UniProt: B1I7T0
Position
complement(1799188..1800192)
Genome map
AA seq 334 aa AA seqDB search
MKEIIEKLAKFENLSGVEMTDVIERIVTGRVTEAQIASLLLALKMKGETPEERTAIAQVM
RGHAQHIPTEIHDAMDNCGTGGDKSFSFNISTTAAFVLAGGGIHMAKHGNRSISSKSGSA
DVLEALGINLDLKPAELGKVFDKTGIVFLFAKNMHPAMKYIMPARLELGIPTIMNLTGPL
IHPMALETQLLGISRPELLESTAQVLKNMGRKRAIVVAGPEGLDEAGLNGTTKIALLENG
EISLSSFTPEDLGMEGYAMEDIRGGNAQENAEILLSVLKNEASPFLETTVLNAGLGFYAN
GKIDSIKEGVALARQVIARGKALEKLRLLQEYQK
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagattattgaaaaactagcaaaatttgaaaatttatcaggtgtggaaatgacg
gatgtcattgagcgtatcgtaactgggcgtgtaactgaagcgcagattgcttctctcctc
ttagctctcaagatgaagggggaaacacctgaagaacgcacagccattgcccaagtcatg
agaggacatgcccagcatattccaactgagattcatgatgccatggataactgtggtaca
ggtggggacaagtctttcagttttaatatttccacaactgcagcctttgtcttggctggt
ggcggtattcacatggccaagcatggtaaccgctcgatttcttctaaatctggttccgca
gatgtcctcgaagccttgggaatcaatcttgatctcaaaccagctgaactaggtaaggtc
tttgataaaactggaatcgtctttctcttcgctaaaaatatgcacccagctatgaaatac
atcatgccagctcgtttggaattgggaattccaacgattatgaacttgactggtccactg
attcatccaatggctttagaaacacagcttcttggaattagtcgtccagaactcctagaa
agtacagctcaggttttgaaaaatatgggtcgcaaacgtgccatcgtggttgctggacca
gaagggttggatgaagctggcttgaacggaacaaccaagattgcacttcttgaaaatggc
gaaatcagcttgtcaagctttactccagaggatttgggaatggaaggctatgctatggaa
gatattcgtggtgggaatgctcaggaaaatgcagaaattttgcttagcgttctgaaaaac
gaagcaagtccattcttggaaacgacagtcttgaatgctggtcttggtttctatgctaat
ggtaagattgatagcatcaaggaaggagttgccttggcccgtcaagtgattgctagaggc
aaggcccttgaaaaactcagactgttacaggagtaccaaaaatga

DBGET integrated database retrieval system