KEGG   Streptococcus pneumoniae Hungary19A 6: SPH_2222Help
Entry
SPH_2222          CDS       T00658                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
spv  Streptococcus pneumoniae Hungary19A 6
Pathway
spv00260  Glycine, serine and threonine metabolism
spv00750  Vitamin B6 metabolism
spv01100  Metabolic pathways
spv01110  Biosynthesis of secondary metabolites
spv01120  Microbial metabolism in diverse environments
spv01230  Biosynthesis of amino acids
Module
spv_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spv00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPH_2222 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SPH_2222 (thrC)
Enzymes [BR:spv01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SPH_2222 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP DUF4252
Motif
Other DBs
NCBI-ProteinID: ACA36436
UniProt: B1I9B9
Position
complement(2041160..2042644)
Genome map
AA seq 494 aa AA seqDB search
MTLVYQSTRDANNTVTASQAILQGLATDGGLFTPVTYPKVDLDFDKLKDASYQEVAKLVL
SAFLDDFTAEELDYCINNAYDSKFDTPAIAPLVKLDGQYNLELFHGSTIAFKDMALSILP
YFMTTAAKKHGLENKIVILTATSGDTGKAAMAGFADVPGTEIIVFYPKDGVSKIQELQMT
TQTGDNTHVIAIDGNFDDAQTNVKHMFNDVALCEKLTTNKLQFSSANSMNIGRLVPQIVY
YVYAYAQLVKTGEIVAGDKINFTVPTGNFGNILAAFYAKQIGLPVGKLICASNDNNVLTD
FFKTRVYDKKREFKVTTSPSMDILVSSNLERLIFHLLGNNAEKTAELMNALNTQGQYKLT
DFDAEILDLFAAEYATEEETAAEIKRVCELDSYIEDPHTAVASAVYKKYQSATGDVTKTV
IASTASPYKFPVVAVEAVTGKAGLTDFEALAQLHEISGVAVPPAVDGLEIAPVRHKTTVA
AADMQAAVEAYLGL
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgacattagtttatcaatcaacgcgtgatgccaacaatacagtaactgccagccaagca
attttgcaaggtttggcgacggacggcggtttgtttacaccggttacttatccaaaggta
gatttggactttgacaaattgaaagatgcttcttatcaggaagttgctaagctagttttg
tcagcatttttagatgactttacagctgaggagttggactactgtatcaacaatgcctac
gatagcaaatttgatactccagctattgcaccattagtgaaattagatgggcaatacaat
ttggaacttttccatggttcaacgattgcctttaaggatatggccttgtctattttgcca
tactttatgacgactgctgctaagaaacatggtttggagaacaagattgttatcttgaca
gcgacatctggtgacacggggaaagctgctatggcggggtttgcggatgtgcctggtact
gagattatcgtcttttatccaaaggatggtgtcagcaagattcaagagttacaaatgacc
actcaaactggcgacaatactcatgttattgctattgatggtaactttgacgatgcgcaa
acaaatgtgaagcacatgtttaacgacgtggctctttgtgaaaaattgactaccaacaag
ttgcaattttcatcagctaactctatgaacattggtcgtctggtgccacagattgtttat
tatgtttatgcctatgctcagttggtcaagactggtgagatcgtggctggtgataagatt
aacttcacagtaccaacaggaaactttggaaatatcttggctgccttttatgccaaacaa
attggtttgccagttggtaaattaatctgtgcttcaaatgacaataatgtcttgacagac
ttctttaaaacacgtgtctatgacaaaaaacgtgagtttaaggtaacaaccagcccatct
atggatatcttggtatcttcaaacttggagcgcttgattttccatcttttgggaaataat
gctgaaaagacagctgaacttatgaatgccttgaacacgcaaggacaatataagttgaca
gactttgatgcagagattttggacctctttgcagctgaatatgcgactgaggaagaaacg
gcagcagagatcaagcgtgtttgtgagttagattcttatatcgaggaccctcatacagct
gttgcttcagcagtttataaaaaataccaatcggccactggagatgtaactaagacagtg
attgcttcaacagctagtccatacaagttcccagtagttgcagtagaagctgtaactgga
aaagcaggtttaacagactttgaagccttggctcaattacatgaaatctcaggcgttgca
gtgccaccagcagttgatgggcttgaaatagctcctgttcgtcacaagacaactgtagcg
gctgctgatatgcaagcagcggttgaggcttatttaggactttaa

DBGET integrated database retrieval system