KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0161
Entry
SPCG_0161         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB
Motif
Pfam: FtsK_SpoIIIE DUF87 AAA_10 TrwB_AAD_bind ResIII Pox_A32 AAA AAA_19 T2SSE DUF853 AAA_22
Other DBs
NCBI-ProteinID: ACB89413
UniProt: B2IQE9
Position
160675..162060
AA seq 461 aa
MKQRGKRIRPSGKDLVFHFTIASLLPVFLLVVGLFHVKTIQQINWQDFNLSQADKIDIPY
LIISFSVAILICLLVAFVFKRVRYDTVKQLYHRQKLAKMILENKWYESEQVKTEGFFKDS
AGRTKEKITYFPKMYYRLKNGLIQIRVEITLGKYQDQLLHLEKKLESGLYCELTDKELKD
SYVEYTLLYDTIASRISIDEVEAKDGKLRLMKNVWWEYDKLPHMLIAGGTGGGKTYFILT
LIEALLHTDSKLYILDPKNADLADLGSVMANVYYRKEDLLSCIETFYEEMMKRSEEMKQM
KNYKTGKNYAYLGLPAHFLIFDEYVAFMEMLGTKENTAVMNKLKQIVMLGRQAGFFLILA
CQRPDAKYLGDGIRDQFNFRVALGRMSEMGYGMMFGSDVQKDFFLKRIKGRGYVDVGTSV
ISEFYTPLVPKGYDFLEEIKKLSNSRQSTQATCEAEVAGVD
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaaacagcgtggtaaaaggattcgcccatctggtaaagatttagtctttcattttacg
atagcgtcactcctgcctgttttcctgctggttgtcggactgtttcatgtgaagacaatc
cagcagatcaactggcaggattttaacctatcacaagcagataagattgacattccctat
ttaattatcagtttcagtgtcgcaattcttatctgcttgctggtagcgtttgtattcaaa
cgggttcgctatgatacggttaaacaactttaccaccgtcaaaaactggcaaagatgata
cttgaaaacaagtggtatgaatctgaacaggtcaaaacagagggtttctttaaagatagt
gctggtcgtacaaaggaaaagataacctacttccctaaaatgtattatcgacttaaaaat
ggcttgatacagatacgggtggaaatcacgctgggaaaatatcaagaccaactcttacac
ttggaaaagaaattagagagtggcttgtactgtgagctgacggataaagagttaaaggat
tcctatgtggaatatactttgctctatgacaccatagccagtcgtatttctattgatgaa
gtagaagctaaagatggtaaacttcgcttaatgaaaaacgtatggtgggaatatgataag
ctccctcatatgttgattgctggtggtacaggtggcggtaaaacttactttatactgaca
ctgattgaagccttgcttcatacagattcaaaactgtatattcttgacccgaaaaatgct
gaccttgcggacttaggttctgtgatggcaaatgtctactatagaaaagaagacttgctt
tcttgcattgaaacattctatgaagaaatgatgaaacgtagtgaggaaatgaagcagatg
aagaactataagactggcaaaaattatgcttacttaggtctcccggcacacttcttaatc
tttgatgaatacgtcgctttcatggaaatgctgggaacaaaagaaaacaccgcagttatg
aataagctgaaacagattgtcatgttaggtcgtcaagctggcttctttctaatactggct
tgtcaacgtccagacgcaaaatatttaggcgacggaatccgtgatcagtttaatttcaga
gtggctttaggtcgtatgtctgaaatgggctatggcatgatgtttggcagtgacgtacaa
aaggatttcttcttaaagcgaatcaaaggtcgtggctatgttgatgtaggaacaagtgtc
atatcagagttttatactccccttgtaccaaaaggatatgatttcttggaggaaattaaa
aagttatccaacagcagacagtccacgcaggcgacgtgcgaagcggaagtcgcaggtgtg
gactga

DBGET integrated database retrieval system