KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0163Help
Entry
SPCG_0163         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbC
Motif
Other DBs
NCBI-ProteinID: ACB89415
UniProt: B2IRY5
Position
163486..163707
Genome map
AA seq 73 aa AA seqDB search
MNFGQNLYNWFLSNAQSLVLLAIVVIGLYLGFKHEFSKLIGFLIIAIIAVGLVFNAAGVK
DILLELFNRIIGA
NT seq 222 nt NT seq  +upstreamnt  +downstreamnt
atgaattttggacaaaacctttataactggtttctatcaaacgctcaatcactggtgctt
ttagcaatcgttgtgattggcttgtatcttggcttcaagcatgagtttagcaaactgatt
ggctttttaattattgcgattattgcggttggcttagtcttcaacgctgctggagtaaaa
gacattttactagagctattcaatcgcattattggtgcttaa

DBGET integrated database retrieval system