KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0165Help
Entry
SPCG_0165         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TcpE
Motif
Other DBs
NCBI-ProteinID: ACB89417
UniProt: B2IRY7
Position
164296..164802
Genome map
AA seq 168 aa AA seqDB search
MGFLKSSIKSVGTLLLADFLFYGVAQSATPIFYERIDYMKKIRSYTSIWSVEKVLYSIND
FRLPFPITFTQMTWFVVSLFAVMILGNLPPLSMIEGAFLKYFGIPVAFTWFMSTKTFDGK
KPYGFLKSVIAYALRPKLTYAGKKVTLGRNQPQEAITAVRSEFYGISN
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttgaaatcgtctattaaatctgtcggtacattactactggcagattttcta
ttttacggggtggctcaatcagctacccctattttttatgaaaggattgattacatgaag
aaaatacgaagctataccagtatctggtctgtggaaaaggtactgtattctatcaatgat
tttagacttccgtttcccataacctttacgcaaatgacatggtttgtcgtgtcactcttt
gcagtgatgatacttggcaacttgccccctctttccatgatagagggagcatttctcaaa
tactttgggattcctgtggctttcacatggtttatgtctacaaaaacttttgatggtaaa
aagccttatggatttttgaagtctgtcattgcttatgcactgcgaccaaagctgacctat
gcaggaaaaaaagtaacgcttggcagaaaccagccacaagaagccattacagcagttagg
agtgaattttatggcatatccaattaa

DBGET integrated database retrieval system