KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0166Help
Entry
SPCG_0166         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_10 DUF853 TBCC_N
Motif
Other DBs
NCBI-ProteinID: ACB89418
UniProt: B2IRY8
Position
164735..167233
Genome map
AA seq 832 aa AA seqDB search
MAETSHKKPLQQLGVNFMAYPIKYIENNLVWNKDGECYAYYELVPYNYSFLSPEQKIQVH
DSFRQLIAQNRDGKIHALQISTESSIRSAQERSKNEVTGKLKAVAYDKIDQQTDALISMI
GENQVNYRFFIGFKLLLNDQEFSMKSLTVEAKNALSDFVYDVNHKLMGDFVSMSNDEILR
FQKMEKLLENKISRRFKIRRLDKDDFGYLIEHLYGQTGTAYEEYEYHLSKKKLDNETLIK
YYDLIKPTRCLVEEKQRYLKIQQEDETVYVAYFTINSIVGELDFPSSEIFYYQQQQFTFP
IDTSMNVEIVANRKALSTVRNKKKELKDLDNHAWQSDNETSSNVAEALESVNELETNLDQ
SKESMYKLSYVVRVSANDLDELKRRCNEVKDFYDDLSVKLVRPFGDMLGLHEEFLPASKR
YMNDYIQYVTSDFLAGLGFGATQMLGENEGIYVGYSLDTGRNVYLKPALASQGVKGSVTN
ALASAFVGSLGGGKSFANNLIVYYAVLYGAQAVIVDPKAERGRWKETLPEISHEINIVTL
TSDEKNKGLLDPYVIMKNPKDSESLAIDILTFLTGISSRDGERFPILRKAIRAVTNSEVR
GLMKVIEELRVENTPLSTSIADHIESFTDYDFAHLLFSNGYVEQSISLEKQLNIIQVADL
VLPDKETSFEEYTTMELLSVAMLIVISTFALDFIHTDRSIFKIVDLDEAWSFLQVAQGKT
LSMKLVRAGRAMNAGVYFVTQNTDDLLDEKLKNNLGLKFAFRSTDLNEIKKTLAFFGVDP
EDENNQKRLRDLENGQCLISDLYGRVGVIQFHPVFEELLHAFDTRPPVRKEV
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
ttggcagaaaccagccacaagaagccattacagcagttaggagtgaattttatggcatat
ccaattaaatacattgaaaacaatctcgtctggaataaagacggggaatgttatgcttac
tatgagcttgttccttacaattactcatttctaagtccagaacagaaaatacaagtgcat
gattctttcagacagcttatcgcacaaaatcgtgatggcaaaattcatgctttacaaatc
agtacagaatccagcatacgttctgcacaagagcgttccaaaaatgaagtcactggcaag
ctcaaagcggttgcctatgacaaaatcgaccaacagacagacgctttaatatccatgatt
ggcgaaaatcaagtgaactaccgtttctttatcggctttaagttgcttctcaacgatcag
gagttttctatgaaaagtcttaccgttgaagcaaaaaatgctttgtctgattttgtctat
gatgtgaaccataagctgatgggcgattttgttagtatgagtaatgatgaaatcctgcgt
tttcagaagatggaaaagctcttagaaaataaaatctctcgtcgtttcaaaatccgcagg
ttagataaggacgacttcggctatctgattgaacacctttacggacagacaggcactgcc
tatgaagagtatgagtaccatctatcaaagaaaaagctggataatgaaacgctgattaaa
tactatgacttgattaagcctactcgctgtttggtggaagaaaaacagcgatatttgaaa
atccagcaggaagatgaaaccgtctatgtagcttactttaccattaacagcattgtcgga
gaactggacttcccgtcctctgaaatcttctactaccagcaacagcaatttacattcccg
attgatacgtcaatgaatgtggaaattgtagcgaatcgtaaagccctatctactgtccgc
aataaaaagaaagaactgaaagacttggataaccacgcttggcaaagtgataatgaaacc
agctccaatgtggcggaagctctggaaagtgtgaatgagctggaaaccaatttagaccaa
agcaaggaatctatgtacaagctgtcttatgtggtaagggtatcagcaaatgatcttgac
gaactcaaacgtcgttgtaatgaagtgaaagatttttatgacgatttaagcgtaaaactg
gtacgaccatttggggatatgctcggcttacatgaagaatttttacctgccagcaagcgt
tatatgaatgattatattcaatacgtgacctctgatttcctcgctggtttaggttttggt
gctactcaaatgctgggggaaaatgaggggatttatgttggctacagcttagatactgga
cgcaatgtctatctgaaacctgctcttgccagtcaaggggttaagggttcagtaaccaat
gcgttagcgtcggcttttgttggttcgctgggtggtggtaaatcctttgcgaataacctt
atcgtctattatgcggtgctttatggggcacaagcagtgattgtagacccaaaagcagaa
cgtggcagatggaaagaaaccttgccagagatttcccatgaaatcaatatcgtcactctg
acttctgatgagaaaaacaaaggcttacttgacccttatgtgattatgaaaaatcccaaa
gattctgaatcactggctattgatattctgacattccttacggggatttcctctcgtgat
ggggaacgcttcccaatccttagaaaagccattcgtgcagtaaccaatagtgaagtacga
gggttgatgaaagtgattgaggaattacgggttgagaatacgccactaagtaccagtata
gccgaccatatcgaaagttttacagactatgactttgcacatttattattcagtaatggt
tatgtggagcagtctatcagcttagaaaaacaactgaacattatacaggttgcggacttg
gtacttcccgacaaggaaacttcctttgaggaatataccactatggagcttttatccgtt
gctatgctgattgtcattagtacctttgctttagactttatccatacagaccgaagcatt
ttcaagattgtagatttagacgaagcatggagctttttacaggtagcacaaggaaaaaca
ctatctatgaagctggttcgggctggtcgtgctatgaacgctggggtatatttcgtgacc
caaaatacagacgacctcttagatgaaaaactgaaaaataacctcggcttaaaatttgca
tttcgttccactgaccttaacgagattaaaaagaccttagccttttttggtgtagaccca
gaggacgaaaacaatcagaagcgattgcgtgatttggaaaacgggcaatgccttatcagt
gatttatatggtcgtgtcggtgtgatacagttccaccctgtatttgaagaactgctccat
gcctttgataccagaccacctgtgcgaaaagaggtgtaa

DBGET integrated database retrieval system