KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0167
Entry
SPCG_0167         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB
Motif
Pfam: TrbL YtxH
Other DBs
NCBI-ProteinID: ACB89419
UniProt: B2IRY9
Position
167236..169413
AA seq 725 aa
MKPSIVNRIKSNWTLKRLGKVAMTVAFTLVIAIFLLAMLGTVVQAAGLVDDTVNVANEYS
RYPLENYQLDFYVDNSWGWLPWNWSDGIGKQVMYGLYAITNFIWTISLYVSNATGYLVQE
AYSLDFISATADSIGKNMQTLAGVSANGFSTEGFYVGFLLLLILVLGVYVAYTGLIKRET
TKAIHAIMNFVLVFILSASFIAYAPDYIKKINDFSSDISNASLSLGTKIVMPHSDSQGKD
SVDLIRDSLFSIQVQQPWLLLQYNSSDIESIGIDRVESLLSTSPDSNNGEDREKIVAEEI
EDRSNTNLTITKTINRLGTVFFLFVFNIGISIFVFLLTGIMIFSQVLFIIYAMFLPVSFI
LSMIPSFDGMSKRAITKLFNTILTRAGITLIITTAFSISTMLYTLSAGYPFFLIAFLQIV
TFAGIYFKLGDLMSMFSLQSNDSQSVGSRVMRKPRMLMHAHMHRLQRKLGRSMTTLGAGS
AIVTGKKGQSGSGSSARTQADHSRPDGKEKSTLGKRIGQTIGTVADTKDRMVDTASGLKE
QVKDLPTNARYAVYQGKSKVKENVRDLTSSISQTKADRASGRKEQQEQRRKTIAKRRSEM
EQVKQKKQPASSVHERPTTRQEQYHDEQTSKQSNIQTSYKESQQAKQERPAVKSDFSSPK
VERQGNTVQEKTVQKPATSTTTADRTSQRPITKERPSTVQRVPLQNTRSRPPIKTATIKK
VGKKP
NT seq 2178 nt   +upstreamnt  +downstreamnt
gtgaaaccatcaatagtaaacagaataaaatcaaactggacgctgaaacgtctaggtaaa
gtggcaatgacagtggctttcacacttgtgattgccatttttcttttagccatgctggga
acggtggttcaagctgcgggcttggtagatgatacggtcaatgtggcaaatgaatacagc
cgatacccacttgaaaactatcaactggatttttatgtggataatagctggggctggctt
ccgtggaactggtcggacgggattggaaaacaggtcatgtatggactatatgccattacc
aattttatttggacaatcagtttgtatgtttccaatgcgacaggttacttagtacaggaa
gcctattccttagacttcatttccgctacagcagattccattggtaagaatatgcagacc
ttagctggtgtgagtgcaaacggattttcaacagagggtttctatgttggattcctctta
ctcttgattttggttcttggggtttatgttgcctatacgggactgataaagagagaaacc
acaaaggcaattcatgccattatgaattttgtgctggtgtttatcctatcggcttccttt
attgcctacgctcccgactacattaaaaaaatcaatgacttttcatcagacatcagtaat
gccagtttatcacttggcacgaagattgtcatgccccattccgatagtcaaggcaaggac
agcgtggacttaatcagagatagcctgttttccatacaggttcagcaaccgtggctactg
cttcaatacaacagttcagacattgaaagtatcggtattgaccgtgtggaaagcctgctc
tccaccagcccagattccaacaatggcgaagacagagaaaaaattgttgcggaagaaatt
gaagacagaagcaataccaatctaaccattacaaagaccattaaccgtttaggtacagtc
ttcttcctatttgtcttcaatattgggatttccatatttgtattcctattaacaggaatc
atgattttctcgcaggtactttttatcatctatgctatgtttctgcctgtgagctttatt
ttaagcatgattccatcatttgatggtatgtcaaaacgagccataacaaagctctttaat
accattttgacacgagctggaatcacattgattattacgacagcatttagtatttcaacc
atgctctataccttatcggctggttatccgttctttttgattgcttttctacagattgtg
acctttgcaggaatctacttcaagctgggcgatttaatgagtatgttttctctacagagt
aacgattctcaaagtgtgggaagtcgtgtgatgagaaaacctcgtatgcttatgcacgct
cacatgcaccgtctacagcggaaacttggacgttccatgactactctaggggctgggtct
gccattgttacaggtaaaaaaggacagtcgggttcggggagttctgcaaggacacaagca
gatcactcccgaccagacggaaaggaaaaatcaacacttggaaaacgtatcggtcaaacc
atcggtacagtagctgataccaaagacagaatggtagacactgctagtggtttgaaagaa
caggttaaagatttgccgaccaatgcaagatatgcagtatatcaaggaaaatccaaagta
aaagagaatgtccgtgatttaaccagtagtatttctcaaaccaaagcggacagagccagt
ggacgcaaggaacagcaggaacaaaggcgaaaaaccattgcgaagcgtcgctctgaaatg
gaacaggtcaaacagaaaaaacagcctgcttcttctgttcatgaaagaccgactacaaga
caagaacaatatcatgatgaacagacctcaaaacagtctaatattcagacttcatataag
gaatctcaacaagccaaacaagagcgtccagcagttaagtccgatttttcaagtccaaaa
gtggaacgccaaggcaataccgttcaagaaaaaaccgttcaaaagccagcaacttcaacc
actacagcagatagaacttcacaacgtccaatcacaaaagaacgtccgtctactgttcaa
agagtaccactacaaaatacaagaagtagaccaccaatcaaaaccgccaccattaagaaa
gtcggtaagaaaccatga

DBGET integrated database retrieval system