KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0168
Entry
SPCG_0168         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB
Motif
Pfam: Lysozyme_like NLPC_P60 SLT DUF1175 CHAP
Other DBs
NCBI-ProteinID: ACB89420
UniProt: B2IRZ0
Position
169410..170411
AA seq 333 aa
MKLKTLVIGGSGLFLMVFSLLLFVAILFSDEQDSGISNIHYGGVNVSAEVLAHKPMVEKY
AKEYGVEEYVNILLAIIQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLA
SSERLSVDLESVIQSYNYGGGFLGYVANRGNKYTFELAQSFSKEYSGGEKVSYPNPIAIP
INGGWRYNYGNMFYVQLVTQYLVTTEFDDDTVQAIMDEALKYEGWRYVYGGASPTTSFDC
SGLTQWTYGKAGINLPRTAQQQYDVTQHIPLSEAQAGDLVFFHSTYNAGSYITHVGIYLG
NNRMFHAGDPIGYADLTSPYWQQHLVGAGRIKQ
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgaagttgaaaactttagtgattggtggttctggattattcttgatggtcttctcactg
cttctgtttgttgccattttattttcagatgaacaggacagcggaatttccaatattcat
tatggaggtgtgaatgtttccgcagaagtgctggctcataagcctatggtagaaaaatat
gccaaagaatatggcgttgaagaatatgtcaacatacttcttgcgattatacaggtggaa
tcgggcggtactgcggaagatgttatgcagtcctcggaatccctcggtcttccacctaat
tcattgagtacagaagaatccattaagcaaggtgtgaagtatttcagtgaattattagcc
agtagcgaaaggctcagtgtagatttagaatcggttatccagtcctacaattatggtggt
ggtttcttagggtatgtggctaatcgtggaaataaatatacctttgaactggctcaaagt
ttctcaaaagagtattcaggtggcgaaaaagtgtcttaccccaatcccatagccatacct
atcaatgggggctggcgatacaactatggcaatatgttttatgtgcaactggtaacgcag
tatcttgtcacaacagagtttgatgatgatacggtacaagccatcatggacgaagcactg
aaatatgagggctggcgatacgtttacggtggagcttccccgactacttcttttgattgt
agcggactgacacaatggacgtatggaaaagctggaattaacttaccacgaaccgcacaa
cagcaatatgatgtgacccagcatatcccactatcggaagcacaagctggcgatttggtt
ttctttcattctacctataacgctggctcttatattactcatgttgggatataccttggc
aataaccgtatgtttcatgcaggcgacccaatcggttatgccgacttaacaagcccctac
tggcaacagcatttagtgggagcaggacgaatcaaacaatga

DBGET integrated database retrieval system