KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0169Help
Entry
SPCG_0169         CDS       T00690                                 

Definition
(GenBank) hypothetical protein
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TpcC NuiA
Motif
Other DBs
NCBI-ProteinID: ACB89421
UniProt: B2IRZ1
Position
170408..171343
Genome map
AA seq 311 aa AA seqDB search
MRKEDLMMKFRKNQNKEKQIPKEKKPRVYYKVNPHKKVVIALWVLLGLSFSFAIFKHFTA
IDTHTIHETTIIEKEYVDTHHVENFVENFAKVYYSWEQSDKSIDNRMESLKGYLTDELQA
LNVDTVRKDIPVSSSVRGFQIWTVEPTGDNEFNVTYSVDQLITEGENTKTVHSAYIVSVY
VDGSGNMVLVKNPTITNIPKKSSYKPKAIESEGTVDSITTNEINEFLTTFFKLYPTATAS
ELSYYVNDGILKPIGKEYIFQELVNPIHNRKDNQVTVSLTVEYIDQQTKATQVSQFDLVL
EKNGSNWKIIE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaggaagatttaatgatgaaatttagaaaaaatcagaataaagaaaaacagata
ccaaaggaaaagaaacctcgtgtctactataaggtcaatcctcataaaaaggttgtgatt
gccttgtgggtacttttagggcttagtttcagctttgcgatattcaagcactttacagct
atagatactcatactattcacgaaacaactatcatagaaaaggaatacgttgatactcat
catgtagaaaattttgtagagaactttgcgaaagtctactattcatgggagcaatccgat
aagtccattgataatcgaatggaaagtctaaaaggctatctgacagatgaacttcaagct
ctcaatgttgatacagtacgcaaagatattcctgtatcgtcttctgtaagaggatttcag
atatggacggtagagccaactggcgacaatgagtttaatgtaacctacagtgtagaccag
ctcattacagagggagaaaatacaaagaccgtccactctgcttatatagtgagtgtctat
gtagatggttctggaaatatggtactggttaagaatccgaccattaccaacatacctaag
aaatcaagttataaaccaaaagccattgaaagtgaggggacggttgattccattacaacc
aatgaaatcaatgagtttttaacgacgttcttcaagctctatcctacagcgacagccagt
gaactttcctactatgtgaatgacgggatattaaaaccaatcggaaaagagtacatcttt
caagaactggtaaatcctattcacaatcgtaaggataatcaagtcacggtatcgctgaca
gtggagtatatcgaccagcagaccaaagcaacgcaggtatctcaatttgatttggtactt
gaaaagaacgggagtaattggaagattatagaataa

DBGET integrated database retrieval system