KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_0190Help
Entry
SPCG_0190         CDS       T00690                                 

Gene name
ribA
Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw00740  Riboflavin metabolism
spw00790  Folate biosynthesis
spw01100  Metabolic pathways
spw01110  Biosynthesis of secondary metabolites
Module
spw_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:spw00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    SPCG_0190 (ribA)
   00790 Folate biosynthesis
    SPCG_0190 (ribA)
Enzymes [BR:spw01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     SPCG_0190 (ribA)
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     SPCG_0190 (ribA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2 PucR
Motif
Other DBs
NCBI-ProteinID: ACB89442
UniProt: B2IS12
Structure
PDB: 

Position
complement(192619..193854)
Genome map
AA seq 411 aa AA seqDB search
MDFSRKDNQSMEYRKIQEALEALQKGRLVLVIDDKDRENEGDLICSAQAATTENVNFMAT
YAKGLICMPMSESLANQLMLSPMVENNTDNHKTAFTVSIDYKETTTGISAEERGLTARMC
VAEDITPSDFRRPGHMFPLIAKKGGVLERNGHTEATVDLLKLAGLKECGLCCEIMNHDGK
MMRTDDLIQFSKKHNIPLITIKELQEYRKVYDQLVERVSTVNMPTRYGNFKAISYIDKLN
GEHHLALIMGNIENEANVLCRVHSECLTGDVLGSLRCDCGQQFDKAMKMIVENGSGVLLY
LRQEGRGIGLINKLKAYHLQDQGMDTLDANLALGFEGDLREYHIGAQMLKDLGLQSLHLL
TNNPDKVEQLEKYGITISSRISIEIEANPYDSFYLETKKNRMGHILNMEEK
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atggattttagcagaaaggataatcagtcaatggaatatcgaaaaatacaagaagcatta
gaagcattgcagaagggacgacttgttcttgttatagacgacaaggatagagaaaatgaa
ggagacttaatttgttctgcacaagcagctacaacagaaaatgttaattttatggctact
tatgccaaaggattaatttgtatgcctatgagcgaaagtttagctaatcaattaatgctt
tcacctatggttgaaaacaatacagataatcataagactgcttttacagtttcaattgat
tataaagaaacgaccacaggtatttctgccgaggaaagaggactgaccgcacgtatgtgt
gtagctgaagatataacaccctctgattttcgcaggccaggacacatgtttcctttaatt
gcaaaaaaaggtggtgttctagaaagaaatggacacacagaagcaactgttgatttatta
aaattagctggactaaaagagtgtggcctatgttgtgaaataatgaatcatgatggcaaa
atgatgagaacagatgatttaattcagttttcgaagaaacacaacattccactaattacc
atcaaagaattacaagaatatagaaaagtatatgatcagctggtagaacgagtttcaact
gtcaatatgcctactagatacggtaatttcaaagcaattagctatatagataaactaaat
ggggaacatcatcttgctcttattatgggaaacatagagaatgaagccaatgtattatgt
cgggtccactccgaatgtttaacaggggatgttttaggctccttacgttgcgattgtgga
cagcaattcgataaagctatgaaaatgattgttgagaatggttcgggtgtcttactttac
ttgcgacaggagggacgaggaattggacttatcaataaattaaaagcctatcatttacaa
gatcaaggcatggatacgcttgatgccaatcttgcattaggctttgaaggtgatttaaga
gaatatcatattggagcacaaatgcttaaagatctgggacttcagtcacttcatttactg
acaaataatcctgacaaggttgaacagttagaaaaatatggaattaccatttccagtaga
atatcaatcgaaatagaagccaatccttacgatagtttttatttagaaacaaagaaaaat
cgaatgggtcacattttaaatatggaggaaaaataa

DBGET integrated database retrieval system