KEGG   Streptococcus pneumoniae CGSP14 (serotype 14): SPCG_1644Help
Entry
SPCG_1644         CDS       T00690                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
spw  Streptococcus pneumoniae CGSP14 (serotype 14)
Pathway
spw03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:spw00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPCG_1644 (recR)
DNA repair and recombination proteins [BR:spw03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     SPCG_1644 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SPCG_1644 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: ACB90896
UniProt: B2IRS7
Position
complement(1616270..1616866)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSIC
GRLTDDDPCSICTDPTRDQTTILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPD
DINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctattgccaagttgattgacagttattctaagttaccaggtatc
gggattaagacggctacgcgtctggccttttatacgattgggatgtctgctgatgatgtc
aatgaatttgcaaaaaatctcctttctgctaagagagaattgacatattgttctatttgt
ggacgtttgacagacgacgatccttgttctatctgtactgatccgactcgtgaccagaca
acaattttagttcttgaggatagtagagatgtggcagccatggaaaatatccaagaatac
catggactctatcatgtccttcatggcctcatttctcctatgaatggtatcagtccggac
gatatcaatctcaagagccttatgactcgtcttatggatagtgaggtttcagaagtgatt
gtggcgactaatgctacagcggatggtgaagcgacttccatgtatctttcacgtttgctc
aagccggctggtatcaaggttacgcgtctagcacgaggtctcgctgtgggagcggacatt
gagtatgcggacgaagtgacactcttacgagcgattgaaaatcggacagagttgtaa

DBGET integrated database retrieval system