KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1120Help
Entry
SPG_1120          CDS       T00734                                 

Gene name
fhs
Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00670  One carbon pool by folate
spx01100  Metabolic pathways
spx01120  Microbial metabolism in diverse environments
spx01200  Carbon metabolism
Module
spx_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:spx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    SPG_1120 (fhs)
Enzymes [BR:spx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     SPG_1120 (fhs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: ACF55434
UniProt: B5E4W4
Position
complement(1097966..1099636)
Genome map
AA seq 556 aa AA seqDB search
MKTDIEIAQSIELKPIVDVVEKLGISYDDLELYGKYKAKLSFDKIRAVESNPVGKLILVT
AINPTPAGEGKSTLTIGLADALNKIGKKTMIAIREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLHQGNELGIDQRRILWKRVVDLNDRALRHVTVG
LGGPLNGIPREDGFDITVASEIMAILCLATDIEDLKRRLANIVIGYRYDRTPVSVGDLQV
EGALALILKDAIKPNLVQTIYGTPAFVHGGPFANIAHGCNSVLATTTALHLADYTVTEAG
FGADLGAEKFLDIKTPNLPTSPDAVVIVATLRALKMNGGVAKDALTEENVEAVRAGFANL
KRHVENIRKFGIPAVVAINEFVSDTEAEIAALKELCALIDVPVELASVWADGVEGGVELA
ETVVKTIAENPANYKRLYDNDLSVQEKIEKIVTEIYRGSKVNFEKKAQTQIAQVVQNGWD
KLPICMAKTQYSFSDNPNALGAPENFEITIRELVPKLGAGFIVALTGDVMTMPGLPKRPA
ALNMDVESDGTVLGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatattgaaatcgcacagagtattgagttgaagccaattgttgatgttgta
gagaaacttggtatttcttacgacgatttggagttgtacggaaagtacaaggctaaactc
agctttgataaaattcgtgcagttgagagcaatccagtcggtaaattgatcttggttact
gccatcaacccaacacctgcaggtgaaggaaagtcgacgcttaccattggtcttgcggat
gccttgaacaagattggcaaaaaaaccatgattgctatccgcgaaccgtctcttggtcca
gtcatggggatcaagggtggtgctgctggtggtgggtatgcacaagttctgccaatggaa
gacatcaacctccactttactggagatatgcatgctattacaactgccaacaatgccctt
tctgccttgattgacaaccacttgcaccaagggaatgagctgggaattgatcaacgtcgt
atcctctggaaacgcgttgtggacttgaacgaccgtgcgctccgccatgtgactgttggt
cttggtggtcctctaaacggtattccacgtgaggatggttttgatattacagttgcttca
gaaatcatggcaattctttgcttggcaacggacatcgaggacttgaaacgtcgtttggcg
aatatcgttattggttatcgctatgaccgtacgcctgtttctgtaggtgatttgcaggtt
gagggtgccttggctttgattttgaaggatgctattaagccaaacttggttcagacaatt
tacggtacacctgcctttgtacacggtggtccatttgccaatatcgctcatggctgtaac
tctgttttggcgacgacaacagcccttcacttggctgattacactgttactgaagctggt
tttggtgcggaccttggtgctgagaaattccttgatatcaagacaccaaacttgccaaca
tctccagatgcagttgttattgtcgcaacccttcgtgcccttaagatgaatggtggtgtg
gctaaagatgctctgactgaagaaaatgtagaggcagttcgtgcaggttttgctaacttg
aaacgccacgttgaaaatatccgtaagttcggtattccagcagttgtagctattaacgaa
tttgtatctgatacagaagctgaaattgcagccttaaaagaactctgtgccttaatcgat
gtaccagttgaattggctagtgtctgggctgatggagtagaaggtggagtagaacttgcc
gaaacagttgttaagacaattgctgaaaatccagctaactataaacgtttgtatgataat
gacctttctgtccaagaaaagattgaaaaaattgtcactgaaatctatcgtggtagcaaa
gtgaactttgagaagaaagctcaaacacaaattgctcaagtcgttcaaaacggttgggac
aaattgccaatctgtatggctaaaactcaatacagtttctcagacaatccaaatgcgctt
ggagcaccagaaaactttgaaattaccattcgtgaattggtaccaaaattaggtgcaggc
ttcatcgttgccttaactggtgatgttatgaccatgccaggtcttccaaaacgtccagca
gctctcaacatggatgttgaaagcgatggaactgtactaggcttgttctag

DBGET integrated database retrieval system