KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_1568Help
Entry
SPG_1568          CDS       T00734                                 

Gene name
ileS
Definition
(GenBank) isoleucyl-tRNA synthetase
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:spx00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPG_1568 (ileS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spx01007]
    SPG_1568 (ileS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spx03016]
    SPG_1568 (ileS)
Enzymes [BR:spx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     SPG_1568 (ileS)
Amino acid related enzymes [BR:spx01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPG_1568 (ileS)
Transfer RNA biogenesis [BR:spx03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPG_1568 (ileS)
 Prokaryotic type
   Other AARSs
    SPG_1568 (ileS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1e tRNA-synt_1f zf-FPG_IleRS
Motif
Other DBs
NCBI-ProteinID: ACF56356
UniProt: B5E709
Position
complement(1509451..1512243)
Genome map
AA seq 930 aa AA seqDB search
MKLKDTLNLGKTEFPMRAGLPTKEPVWQKEWEDAKLYQRRQELNQGKPHFTLHDGPPYAN
GNIHVGHAMNKISKDIIVRSKSMSGFYAPFIPGWDTHGLPIEQVLSKQGVKRKEMDLVEY
LKLCREYALSQVDKQREDFKRLGVSGDWENPYVTLTPDYEAAQIRVFGEMANKGYIYRGA
KPVYWSWSSESALAEAEIEYHDLVSTSLYYANKVKDGKGVLDTDTYIVVWTTTPFTITAS
RGLTVGADIDYVLVQPVGEARKFVVAAELLTSLSEKFGWADVQVLETYRGQELNHIVTEH
PWDTAVEELVILGDHVTTDSGTGIVHTAPGFGEDDYNVGIANNLEVAVTVDERGIMMKNA
GPEFEGQFYEKVVPTVIEKLGNLLLAQEEISHSYPFDWRTKKPIIWRAVPQWFASVSKFR
QEILDEIEKVKFHSEWGKVRLYNMIRDRGDWVISRQRTWGVPLPIFYAEDGTAIMVAETI
EHVAQLFEKHGSSIWWERDAKDLLPEGFTHPGSPNGEFKKETDIMDVWFDSGSSWNGVVV
NRPELTYPADLYLEGSDQYRGWFNSSLITSVANHGVAPYKQILSQGFALDGKGEKMSKSL
GNTIAPSDVEKQFGAEILRLWVTSVDSSNDVRISMDILSQVSETYRKIRNTLRFLIANTS
DFNPAQDTVAYDELRSVDKYMTIRFNQLVKTIRDAYADFEFLTIYKALVNFINVDLSAFY
LDFAKDVVYIEGAKSLERRQMQTVFYDILVKITKLLTPILPHTAEEIWSYLEFETEDFVQ
LSELPEVQTFANQEEILDTWAAFMDFRGQAQKALEEARNAKVIGKSLEAHLTVYPNEVVK
TLLEAVNSNVAQLLIVSELTIAEEPAPEAALSFEDVAFTVERAAGEVCDRCRRIDPTTAE
RSYQAVICDHCASIVEENFADAVAEGFEEK
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcaaagacacccttaatcttgggaaaactgaattcccaatgcgtgcaggcctt
cctaccaaagagccagtttggcaaaaggaatgggaagatgcaaaactttatcaacgtcgt
caagaattgaaccaaggaaaacctcatttcaccttgcatgatggccctccatacgctaac
ggaaatatccacgttggacatgctatgaacaagatttcaaaagatattattgttcgttct
aagtctatgtcaggattttacgcaccatttattcctggttgggatactcatggtctgcca
atcgagcaagtattgtcaaaacaaggtgtcaaacgtaaagaaatggacttggttgagtac
ttgaaactttgccgtgagtacgctctttctcaagtagataaacaacgtgaagattttaaa
cgtttgggtgtttctggtgactgggaaaatccatatgtgaccttgactcctgactatgaa
gcagctcaaattcgtgtatttggtgagatggctaataagggttatatctaccgtggtgcc
aagccagtttactggtcatggtcatctgagtcagcccttgctgaagcagagattgaatac
catgacttggtttcaacttccctttactatgccaacaaggtaaaagatggcaaaggagtt
ctagatacagatacttatatcgttgtctggacaacgactccatttaccatcacagcttct
cgtggtttgacggttggtgcagatattgattacgttttggttcaacctgttggtgaagct
cgtaagtttgtcgttgctgctgaattattgactagcttgtctgagaaatttggctgggct
gatgttcaagttttggaaacttaccgtggccaagaactcaaccacatcgtaacagaacac
ccatgggatacagctgtagaagagttggtaattcttggtgaccacgttacgactgactct
ggtacaggtattgtccatacagcccctggttttggtgaggacgattacaatgttggtatt
gctaataatcttgaagtcgcagtgactgttgatgaacgtggtatcatgatgaagaatgct
ggtcctgaatttgaaggtcaattctatgaaaaggtagttccaactgttattgaaaaactt
ggtaacctccttcttgcccaagaagaaatctctcactcatatccatttgactggcgtact
aagaaaccaatcatctggcgtgcagttccacaatggtttgcctcagtttctaaattccgt
caagaaatcttggacgaaattgaaaaagtgaaattccactcagaatggggtaaagtccgt
ctttacaatatgatccgtgatcgtggtgactgggttatctctcgtcaacgtacttggggt
gttccacttcctatcttctacgctgaagatggtacagctatcatggtagctgaaactatt
gaacacgtagctcaactttttgaaaaacatggttcaagcatttggtgggaacgtgatgcc
aaagacctcttgccagaaggatttactcatccaggttcaccaaacggcgagttcaaaaaa
gaaactgatatcatggacgtttggtttgactcaggttcatcatggaatggagtggtggta
aaccgtcctgaattgacttacccagccgacctttacctagaaggttctgaccaataccgt
ggttggtttaactcatcacttatcacatctgttgccaaccatggcgtagcaccttacaaa
caaatcttgtcacaaggttttgcccttgatggtaaaggtgagaagatgtctaaatctctt
ggaaatactattgctccaagcgatgttgaaaaacaattcggtgctgaaatcttgcgtctc
tgggtaacaagtgttgactcaagcaatgacgtgcgtatctctatggatatcttgagccaa
gtttctgaaacttaccgtaagattcgtaacactcttcgtttcttgattgccaatacatct
gactttaacccagctcaagatacagtcgcttacgatgagcttcgttcagttgataagtac
atgacgattcgctttaaccagcttgtcaagaccattcgtgatgcctatgcagactttgaa
ttcttgacgatctacaaggccttggtgaactttatcaacgttgacttgtcagccttctac
cttgattttgccaaagatgttgtttacattgaaggtgccaaatcactggaacgccgtcaa
atgcagactgtcttctatgacattcttgtcaaaatcaccaaactcttgacaccaatcctt
cctcacactgcggaagaaatttggtcatatcttgagtttgaaacagaagacttcgtccaa
ttgtcagaattaccagaagttcaaacttttgctaaccaagaagaaatcttggatacatgg
gcagccttcatggactttcgtggacaagcacaaaaagccttggaagaagctcgtaatgca
aaagttatcggtaaatcacttgaagcacacttgacagtttatccaaatgaagttgtgaaa
actctactcgaagcagtaaacagcaatgtagctcaacttttgatcgtgtctgagttgacc
atcgcagaagaaccagctccggaagctgcccttagcttcgaagatgtagccttcacagtt
gaacgtgctgctggtgaagtatgtgaccgttgccgtcgtatcgacccaacaacagcagaa
cgcagctaccaggcagttatctgtgaccactgtgcaagcatcgtagaagaaaattttgcg
gatgcagtcgcagaaggatttgaagagaaataa

DBGET integrated database retrieval system