KEGG   Streptococcus pneumoniae G54 (serotype 19F): SPG_2166Help
Entry
SPG_2166          CDS       T00734                                 

Definition
(GenBank) ABC transporter, ATP-binding protein
  KO
K16787  energy-coupling factor transport system ATP-binding protein [EC:3.6.3.-]
Organism
spx  Streptococcus pneumoniae G54 (serotype 19F)
Pathway
spx02010  ABC transporters
Module
spx_M00582  Energy-coupling factor transport system
Brite
KEGG Orthology (KO) [BR:spx00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    SPG_2166
Enzymes [BR:spx01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.-  
     SPG_2166
Transporters [BR:spx02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter [MD:M00582] [OT]
    Shared module
     SPG_2166
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_23 AAA_22 RsgA_GTPase AAA_16 AAA_5 AAA_30 DUF87 Mg_chelatase FtsK_SpoIIIE AAA_18 MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: ACF56700
Position
complement(2056807..2057646)
Genome map
AA seq 279 aa AA seqDB search
MGIALENVNFTYQEGTPLASAALSDVSLTIEDGSYTALIGHTGSGKSTILQLLNGLLVPS
QGSVRVFDTLITSTSKNKDIRQIRKQVGLVFQFAENQIFEETVLKDVAFGPQNFGVSEED
AVKTAREKLALVGIDESLFDRSPFELSGGQMRRVAIAGILAMEPAILVLDEPTAGLDPLG
RKELMTLFKKLHQSGMTIVLVTHLMDDVAEYANQVYVMEKGRLVKGGKPSDVFQDVVFME
EVQLGVPKITAFCKRLADRGVSFKRLPIKIEEFKESLNG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgggaattgctctagaaaatgtgaattttacatatcaagaaggtactcccttagcttca
gcagctttgtcggatgtttctttgacgattgaagatggctcttatacagctttaattggg
cacacaggtagtggtaaatcaactattttacaactcttaaatggtttattggtgccaagt
caagggagtgtgagggtttttgataccttaatcacctcgacttctaaaaataaagatatt
cgtcaaattagaaaacaggttggcttggtatttcagtttgctgaaaatcagatttttgaa
gaaacggttttgaaggacgttgcttttggaccgcaaaattttggagtttctgaagaagat
gctgtgaagactgcgcgtgagaaactggctctggttggaattgatgaatcactttttgat
cgtagtccgtttgagctgtcagggggacaaatgagacgtgttgccattgcaggcatactt
gccatggagccagctatattagtcttagatgagccaacagctggtctagatcctctaggg
agaaaagagttgatgaccctgttcaaaaaactccaccagtcagggatgaccatcgtcttg
gtaacgcatttgatggatgatgttgctgaatatgcaaatcaagtctatgtaatggaaaag
ggacgtttagtaaaggggggcaaaccaagtgatgtctttcaagacgttgtttttatggaa
gaagttcagttgggagtacctaaaattacggccttttgtaaacgattggctgatagaggc
gtgtcatttaaacgattaccgattaagatagaggagttcaaggagtcgctaaatggatag

DBGET integrated database retrieval system