KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0140Help
Entry
SPy_0140          CDS       T00050                                 

Definition
(RefSeq) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00071  Fatty acid degradation
spy00072  Synthesis and degradation of ketone bodies
spy00280  Valine, leucine and isoleucine degradation
spy00310  Lysine degradation
spy00362  Benzoate degradation
spy00380  Tryptophan metabolism
spy00620  Pyruvate metabolism
spy00630  Glyoxylate and dicarboxylate metabolism
spy00640  Propanoate metabolism
spy00650  Butanoate metabolism
spy00900  Terpenoid backbone biosynthesis
spy01100  Metabolic pathways
spy01110  Biosynthesis of secondary metabolites
spy01120  Microbial metabolism in diverse environments
spy01130  Biosynthesis of antibiotics
spy01200  Carbon metabolism
spy01212  Fatty acid metabolism
spy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPy_0140
   00630 Glyoxylate and dicarboxylate metabolism
    SPy_0140
   00640 Propanoate metabolism
    SPy_0140
   00650 Butanoate metabolism
    SPy_0140
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPy_0140
   00072 Synthesis and degradation of ketone bodies
    SPy_0140
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPy_0140
   00310 Lysine degradation
    SPy_0140
   00380 Tryptophan metabolism
    SPy_0140
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPy_0140
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPy_0140
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPy_0140
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spy04147]
    SPy_0140
Enzymes [BR:spy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPy_0140
Exosome [BR:spy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPy_0140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-GeneID: 900469
NCBI-ProteinID: NP_268525
UniProt: Q9A1R4
Position
128935..130119
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgcccggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagttggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcggcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system