KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0422Help
Entry
SPy_0422          CDS       T00050                                 

Gene name
metS
Definition
(RefSeq) putative methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00450  Selenocompound metabolism
spy00970  Aminoacyl-tRNA biosynthesis
spy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SPy_0422 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPy_0422 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spy01007]
    SPy_0422 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spy03016]
    SPy_0422 (metS)
Enzymes [BR:spy01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SPy_0422 (metS)
Amino acid related enzymes [BR:spy01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SPy_0422 (metS)
Transfer RNA biogenesis [BR:spy03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SPy_0422 (metS)
 Prokaryotic type
   Other AARSs
    SPy_0422 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Imm21
Motif
Other DBs
NCBI-GeneID: 900674
NCBI-ProteinID: NP_268725
UniProt: Q9A178
Position
350778..352778
Genome map
AA seq 666 aa AA seqDB search
MMKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTK
AKEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYL
GEYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYDDR
LVAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDA
LLNYATALGYRQANHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAH
GWFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYE
LANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPR
ALEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRLVAHVIQPFMMETS
AAIMAQLGLEPVSDLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYIKAQMGDSSAIS
QEKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKEVSKVEGSEKLLRFRVDAGDGQDRQ
ILSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYISQGMILSAEHGDQLTVLTVDSSVP
NGSIIG
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaaccattttacattacgacacccatttattacccatctgggaaattacac
attggttctgcctatacaactattgcttgtgatgtcttggcacgctacaagcgcctgatg
ggccatgaggtcttttacctcacaggactagatgaacacggacaaaagattcaaaccaag
gcaaaagaagctggtattacacctcaaacctacgttgataacatggcaaaggatgtcaaa
gccctttggcaattgctagatatttcctatgacacatttatccggacaacggacgattac
cacgaagaggtcgttgctgctgtctttgaaaaattgctggcgcaagatgacatttacctt
ggcgaatactctggttggtattctgtctctgatgaggaatttttcactgaaagccaatta
aaagaagtctttagagatgaagacggtcaggttattggagggattgccccatcaggtcat
gaggtcgagtgggtctctgaagaatcctacttcctacgccttagcaaatacgatgatcgt
cttgtggccttctttaaagagcgacctgactttatccaaccagatggtcgtatgaatgaa
atggtgaaaaactttatcgagccaggcctagaagatttggctgttagccgtactaccttt
acatggggtgtacctgttccatcagacccaaaacacgtggtttatgtctggatcgatgcc
ctcttaaactacgcgacagctcttggttatcgtcaagctaatcacgctaactttgataag
ttttggaatggaacggttttccacatggttggaaaagatatcttgcgttttcatagcatc
tactggccaattttactcatgatgcttgatttaccaatgccagaccgcttaattgcccat
ggttggtttgtcatgaaagacggtaaaatgtctaaatcaaaaggcaatgtggtctatcca
gaaatgttagttgagcgctttggacttgatcctcttcgttattacctcatgcgttctttg
ccagttggttcagacgggacctttacccctgaagattatgtgggtcgtatcaactatgag
ttagccaacgaccttggcaatttattgaaccgtaccgttgccatgatcaacaagtatttt
gacggcacggtgccagcttatgttgacaatggaactgcctttgatgctgacttaagtcaa
ctgattgatgctcagctagcagactaccataagcacatggaagcggtggactacccacgc
gccttggaggctgtttggaccatcatcgctcgtaccaacaaatacatcgatgaaaccgct
ccttgggtgctcgctaaagaagatggtgacaaagctcaactagccagtgtcatggcacac
ttagcagccagcttgcgtctggtcgctcatgtgatccaaccctttatgatggaaacatca
gctgctatcatggcccagcttggtttggaacctgtttctgatttgtcaacacttgctcta
gcagattttcctgccaatacaaaggttgttgccaaagggacaccgattttcccacgtctt
gacatggaagctgagattgactacatcaaagcccaaatgggtgacagctcagctatttcc
caagaaaaagaatgggtccctgaagaggttgcgctcaaatctgaaaaagacgtcatcaca
tttgaaacctttgatgctgtggaaatccgtgtggcagaagtcaaggaagtgtcaaaagtg
gaaggttcagaaaaattgctgcgctttagagtagatgcaggagacgggcaagaccgtcaa
atcttgtcaggtattgccaaattttaccccaacgaacaagaattagtgggtaaaaaacta
caaattgttgctaacctgaaaccgcgtaaaatgatgaaaaaatacatcagtcaagggatg
attctatcagcagagcatggagatcagctaacggtcttaaccgttgattcctctgttcca
aatggaagtatcattggctga

DBGET integrated database retrieval system