KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_0613Help
Entry
SPy_0613          CDS       T00050                                 

Gene name
tpi
Definition
(RefSeq) putative triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00010  Glycolysis / Gluconeogenesis
spy00051  Fructose and mannose metabolism
spy00562  Inositol phosphate metabolism
spy01100  Metabolic pathways
spy01110  Biosynthesis of secondary metabolites
spy01120  Microbial metabolism in diverse environments
spy01130  Biosynthesis of antibiotics
spy01200  Carbon metabolism
spy01230  Biosynthesis of amino acids
Module
spy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
spy_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:spy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPy_0613 (tpi)
   00051 Fructose and mannose metabolism
    SPy_0613 (tpi)
   00562 Inositol phosphate metabolism
    SPy_0613 (tpi)
Enzymes [BR:spy01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SPy_0613 (tpi)
Exosome [BR:spy04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SPy_0613 (tpi)
  Exosomal proteins of bladder cancer cells
   SPy_0613 (tpi)
  Exosomal proteins of melanoma cells
   SPy_0613 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 900818
NCBI-ProteinID: NP_268866
UniProt: P69887
Position
493635..494393
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKNPQEAKAFVEAVASKLPSTDLVDVAVAAPAVDLVTTIEAAKDSVL
KVAAQNCYFENTGAFTGETSPKVLAEMGADYVVIGHSERRDYFHETDEDINKKAKAIFAN
GLTPIVCCGESLETYEAGKAVEFVGAQVSAALAGLSAEQVASLVLAYEPIWAIGTGKSAT
QDDAQNMCKAVRDVVAADFGQEVADKVRVQYGGSVKPENVKDYMACPDVDGALVGGASLE
ADSFLALLDFLN
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattattgctggtaactggaaaatgaacaaaaaccctcaagaagca
aaagcattcgttgaggctgtagcaagcaaattaccttcaactgaccttgttgatgttgcc
gtagcagccccagctgttgatttggtaaccactattgaagctgctaaagattcagttctt
aaagttgctgcacaaaactgctactttgaaaacacaggggcattcactggtgaaacatca
ccaaaagtgcttgctgaaatgggagctgactatgttgtgattggtcactcagaacgccgt
gattacttccatgaaacagatgaagacattaataaaaaagccaaagcaatctttgctaac
ggtttaactccaattgtttgttgtggtgagtctcttgaaacttatgaagctggtaaagcc
gttgagtttgtaggtgcgcaagtttcagcagcacttgcaggtctttcagcagagcaagta
gcttcacttgttttagcttatgagccaatctgggctatcggtactggtaaatcagctact
caagatgatgctcaaaacatgtgtaaagctgttcgtgatgtggtagcagcagactttggg
caagaagttgctgataaagttcgcgttcaatacggtggttctgtaaaacctgaaaacgtt
aaagattacatggcttgtccagatgttgacggtgcccttgtaggtggtgcatcacttgaa
gctgatagcttccttgctttgcttgatttccttaactaa

DBGET integrated database retrieval system