KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1043Help
Entry
SPy_1043          CDS       T00050                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00627  Aminobenzoate degradation
spy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    SPy_1043
Enzymes [BR:spy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     SPy_1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 901174
NCBI-ProteinID: NP_269213
UniProt: Q99ZW4
Structure
PDB: 

Position
852875..853639
Genome map
AA seq 254 aa AA seqDB search
MPYKGYLIDLDGTIYQGKNRIPAGERFIKRLQERGIPYLLVTNNTTRTPEMVQSMLANQF
HVETSIETIYTATMATVDYMNDMNRGKTAYVIGETGLKSAIAAAGYVEELENPAYVVVGL
DSQVTYEMLAIATLAIQKGALFIGTNPDLNIPTERGLMPGAGALNALLEAATRVKPVFIG
KPNAIIMNKSLEVLGIQRSEAVMVGDNYLTDIMAGIQNDIATILVTTGFTRPEEVPTLPI
QPDHVLSSLDEWRL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
gtgccttataagggttatttaattgatttagacggaacgatttaccaagggaaaaaccgt
attccagcaggggagcggtttatcaaacgcctacaagaaagaggcattccctatttatta
gtgactaataataccacaagaacacccgaaatggtgcaaagcatgctggctaatcagttt
catgttgagacaagcattgagaccatttatacggctaccatggcaaccgtcgattacatg
aatgacatgaaccgtggcaagacagcttacgttattggagaaacagggctcaaatcagct
attgcagcagcaggttacgtagaagaacttgagaatcccgcttacgtggtggttggttta
gacagtcaggtgacctatgagatgttggctatagccaccttggctattcaaaaaggtgcc
ctctttattgggacaaatcctgatttaaacattccaaccgaacgtggtttgatgccagga
gcaggtgcattgaatgccttactagaagctgccacacgtgtaaaacctgtttttattggc
aagcccaacgctatcattatgaataaatcactagaggtattgggcattcagcgctctgag
gctgtcatggttggcgataattacttgactgatatcatggcaggtattcaaaatgatatt
gcaacgatcctcgtgacaacaggctttaccagacctgaagaggtaccaaccttaccaatt
cagccagatcatgtcctatccagccttgatgagtggaggttgtga

DBGET integrated database retrieval system