KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1083Help
Entry
SPy_1083          CDS       T00050                                 

Gene name
srtA
Definition
(RefSeq) lantibiotic precursor
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gallidermin
Motif
Other DBs
NCBI-GeneID: 901208
NCBI-ProteinID: NP_269245
UniProt: P0C0H9
Position
888693..888833
Genome map
AA seq 46 aa AA seqDB search
MNNTIKDFDLDLKTNKKDTATPYVGSRYLCTPGSCWKLVCFTTTVK
NT seq 141 nt NT seq  +upstreamnt  +downstreamnt
atgaataacacaattaaagactttgatctcgatttgaaaacaaataaaaaagacactgct
acaccttatgttggtagccgttacctatgtacccctggttcttgttggaaattagtttgc
tttacaacaactgttaaataa

DBGET integrated database retrieval system