KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_1770Help
Entry
SPy_1770          CDS       T00050                                 

Gene name
gatB
Definition
(RefSeq) putative Glu-tRNAGln amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00970  Aminoacyl-tRNA biosynthesis
spy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SPy_1770 (gatB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:spy03029]
    SPy_1770 (gatB)
Enzymes [BR:spy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     SPy_1770 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     SPy_1770 (gatB)
Mitochondrial biogenesis [BR:spy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    SPy_1770 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey Chlam_vir
Motif
Other DBs
NCBI-GeneID: 902005
NCBI-ProteinID: NP_269788
UniProt: Q99YC1
Position
complement(1464145..1465584)
Genome map
AA seq 479 aa AA seqDB search
MNFETIIGLEVHVELNTNSKIFSPSSAHFGEDPNANTNVIDWSFPGVLPVMNKGVIDAGI
KAALALNMDIHKEMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIDIKLEDGSTKKIRIE
RAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEIIQYTG
ISDVKMEEGSMRVDANISLRPYGQEQFGTKTELKNLNSFSNVRKGLEFEVERQAKLLRSG
GVIRQETRRYDEANKGTILMRVKEGAADYRYFPEPDLPLYEIDDAWIDEMRAQLPQFPAQ
RRAKYEEELGLSAYDASQLTATKVLSDFFETAVSLGGDAKQVSNWLQGEVAQFLNAEGKT
IEEIALTPENLVEMIAIIADGTISSKMAKKVFVHLAKNGGSARAYVEKAGLVQISDPAVL
VPIIHQVFADNEAAVADFKSGKRNADKAFTGFLMKATKGQANPQVAQQLLAQELQKLRD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattttgaaaccattattgggcttgaagtccatgtggaattaaataccaattccaaa
attttctcaccttcgtcagctcactttggtgaggacccaaatgccaacacgaatgtgatt
gattggtctttcccaggggtcttaccagtcatgaacaaaggggtgattgatgcgggcata
aaagcagcgcttgcccttaatatggacatccataaagagatgcactttgaccgcaaaaat
tatttctacccagataatcctaaagcttatcaaatttcacagtttgatgagccgattggc
tacaacggctggattgatatcaaactagaagacggttcaaccaagaaaattcgtattgaa
cgcgcacacttggaagaagatgctggtaaaaacactcatggcacagatggttattcttat
gtggaccttaaccgccaaggagttcctttgattgagattgtgtcagaagccgacatgcgt
tctcctgaagaagcctatgcttatttgacagctctgaaagaaatcatccagtatacgggt
atttctgatgtcaagatggaagaaggctccatgcgtgtggatgccaatatttctcttcgt
ccttacgggcaagaacaatttggaacaaagaccgaattgaaaaacttgaactccttctca
aatgtccgtaaagggcttgaatttgaggtggaacgtcaagccaaactcttgcgttcaggt
ggtgtgatacgccaagaaacgcgccgctatgacgaagcgaataaggggactattttgatg
cgggtcaaagaaggggcagcggactatcgttatttcccagaaccagacctgccattatat
gagattgatgatgcttggattgacgagatgcgtgctcaattacctcaattcccagctcag
cgtcgtgctaaatacgaagaggaacttggcctctcagcttatgatgctagccagctaaca
gctaccaaagtcttgtcagatttctttgaaactgcagtaagtcttggtggcgatgccaag
caagtctctaactggttgcaaggagaagttgcccaattcttaaatgcagaaggcaaaacc
attgaagaaatcgctctgacaccagaaaatttggtggagatgattgctatcattgctgat
ggtacaatctcttctaaaatggctaagaaggtctttgtgcatttggctaaaaacggtggc
tcagcacgtgcctacgtcgaaaaggcaggacttgttcagatttctgatcccgctgttttg
gtaccaattattcaccaagtctttgctgataatgaagctgcagtagctgatttcaaatca
ggcaaacgtaatgctgataaggctttcacaggcttcttgatgaaggcaaccaaaggtcaa
gctaatccacaagtcgctcaacaattattggcacaagaattgcaaaaattgcgagattga

DBGET integrated database retrieval system