KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_2037Help
Entry
SPy_2037          CDS       T00050                                 

Definition
(RefSeq) hypothetical protein
  KO
K07533  foldase protein PrsA [EC:5.2.1.8]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Brite
KEGG Orthology (KO) [BR:spy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:spy03110]
    SPy_2037
Enzymes [BR:spy01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     SPy_2037
Chaperones and folding catalysts [BR:spy03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    SPy_2037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase_2 Rotamase SurA_N SurA_N_2 SurA_N_3
Motif
Other DBs
NCBI-GeneID: 901688
NCBI-ProteinID: NP_269984
UniProt: P60812
Position
complement(1696936..1697865)
Genome map
AA seq 309 aa AA seqDB search
MKQMNKLITGVVTLATVVTLSACQSSHNNTKLVSMKGDTITVSDFYNETKNTELAQKAML
SLVISRVFETQYANKVSDKEVEKAYKQTADQYGTSFKTVLAQSGLTPETYKKQIRLTKLV
EYAVKEQAKNETISKKDYRQAYDAYTPTMTAEIMQFEKEEDAKAALEAVKAEGADFAAIA
KEKTTAADKKTTYTFDSGETTLPAEVVRAASGLKEGNRSEIITALDPATSKRTYHIIKVT
KKATKKADWKAYQKRLKDIIVTGKLKDPDFQNKVIAKALDKANVKIKDKAFANILAQFAK
PNQKQPAQK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaatgaataaactcattacaggagtggtaacgctggcgacagtcgtgacctta
tcagcttgtcaatcatcacacaacaacaccaaactcgtctcgatgaaaggagacaccatc
actgtcagtgacttctacaatgagaccaaaaacacagaactcgcacaaaaagccatgtta
agcttggtgattagccgcgtttttgagacacaatatgccaacaaagtctctgacaaagag
gttgaaaaagcctataaacaaaccgcagaccaatacggtacatcctttaagacagtccta
gcacaatcaggcttaacgccagaaacctataaaaaacaaattcgcctcacaaaattagtc
gaatatgccgtcaaagaacaagccaaaaacgaaaccatctcaaaaaaagactaccgtcag
gcctatgacgcttataccccaaccatgaccgcagaaatcatgcagtttgaaaaagaagag
gatgccaaagcagcgcttgaagccgtcaaagctgaaggggcagactttgcagctattgcc
aaagaaaaaaccactgcagccgataaaaaaacaacctatacgtttgactcaggcgaaaca
accctaccagcagaagtagttagagctgcatcaggcctcaaagaagggaacagatcagaa
atcatcacagcgcttgatccagccacctcaaaacgcacctaccatatcatcaaagtcacc
aaaaaagcaactaaaaaagcagactggaaagcgtaccaaaaacgcttgaaagacatcatc
gtgactggcaaattaaaagaccctgacttccaaaacaaagtcatcgctaaagctcttgat
aaagcaaatgtcaaaatcaaagacaaagcatttgccaatatcttagcccagtttgcaaaa
cctaaccaaaaacaacctgcccaaaaatag

DBGET integrated database retrieval system