KEGG   Streptococcus pyogenes M1 GAS (serotype M1): SPy_2047Help
Entry
SPy_2047          CDS       T00050                                 

Gene name
gldA
Definition
(RefSeq) putative glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
spy  Streptococcus pyogenes M1 GAS (serotype M1)
Pathway
spy00561  Glycerolipid metabolism
spy00640  Propanoate metabolism
spy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    SPy_2047 (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    SPy_2047 (gldA)
Enzymes [BR:spy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     SPy_2047 (gldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase
Motif
Other DBs
NCBI-GeneID: 901698
NCBI-ProteinID: NP_269991
UniProt: Q99XT5
Position
complement(1703642..1704730)
Genome map
AA seq 362 aa AA seqDB search
MKVFASPSRYIQGKNALFTNVKTLKQLGDSPILLCDDVVYGIVGERFESYLIDNGMTPVH
VAFNGEASDNEISRVVAIAKENGNDVIIGLGGGKTIDSAKAIADLLAVPVIIAPTIASTD
APTSALSVIYTDEGAFEKYIFYSKNPDLVLVDTQVICQAPKRLLASGIADGLATWVEARA
VMQKNGDTMAGGNQTLAGVAIAKACEQTLFADGLKAMASCDRQVVTPALENVIEANTLLS
GLGFESAGLAAAHAIHNGFTALTGAIHHLTHGEKVAYGTLTQLFLENRSREEIDRYIDFY
QAIGMPTTLKEMHLDTATQEDFLKIGRQATMAGETIHQMPFVISPEDVAAALVAVDAYVT
SR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttgcaagtccatctcgttacattcaaggtaaaaatgccttgtttaccaat
gttaaaaccctaaaacaactaggggatagccccattttactgtgtgatgacgtggtgtat
ggcatcgtcggagaaagatttgaaagctatttgatagataatggcatgactcctgttcac
gtagcctttaatggcgaagcctcagataatgaaatcagccgcgtggttgccattgccaag
gaaaatggcaatgatgttattattggacttggtggtggaaaaaccattgacagtgctaag
gctatcgctgacttacttgctgttccggtgattattgccccaaccattgcttcaacagat
gccccaacctcagccttatcggttatttacaccgatgaaggagcctttgaaaaatacatt
ttctattcaaagaatccagatcttgtattggttgacacacaagtgatctgtcaggcacca
aaacgcttattggcgtcagggattgcagatgggttagcaacatgggtagaggcgcgtgct
gttatgcaaaaaaatggagacaccatggcaggtggcaatcaaaccttggcaggagttgcc
attgccaaagcctgtgagcagaccttgtttgcagatggcctaaaagcgatggctagctgt
gacagacaagtcgtgaccccggccttggaaaatgtcattgaagccaatacacttcttagt
gggcttggttttgaaagtgcgggtctggctgctgcacatgccattcacaatggctttaca
gcgctgacaggtgctattcatcaccttacccatggtgaaaaagtcgcctatggcacgttg
acccaactcttcttggaaaatcgttcgcgtgaagaaattgaccgctacatcgacttttac
caagctattggcatgccaacaaccctcaaagaaatgcatttagacacggctactcaagag
gatttcttaaaaattggccgtcaagcaaccatggcaggcgaaaccatccatcaaatgcca
tttgttatcagtccagaagatgtagcagcggctttggttgctgttgatgcctatgttacg
agtcgatag

DBGET integrated database retrieval system