KEGG   Streptococcus pyogenes A20 (serotype M1): A20_0081Help
Entry
A20_0081          CDS       T02335                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Pathway
spya03010  Ribosome
Brite
KEGG Orthology (KO) [BR:spya00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A20_0081 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:spya03011]
    A20_0081 (rplV)
Ribosome [BR:spya03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A20_0081 (rplV)
  Bacteria
    A20_0081 (rplV)
  Archaea
    A20_0081 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AFV37190
Position
67677..68021
Genome map
AA seq 114 aa AA seqDB search
MAEITSAKAMARTVRVSPRKTRLVLDLIRGKKVADAIAILKFTPNKAARVIEKTLNSAIA
NAENNFGLEKANLVVSETFANEGPTMKRFRPRAKGSASPINKRTTHVTVVVSEK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaattacttcagctaaagcaatggctcgtacagtgcgtgtttcacctcgtaaa
acacgtttagtacttgatcttatccgtggtaagaaagttgctgacgcaatcgcaatctta
aaattcactccaaacaaagcagctcgtgttattgagaaaactcttaactcagcaattgct
aacgcagaaaacaactttggtttggaaaaagcaaacttggtagtatctgaaacattcgct
aacgaaggaccaacaatgaaacgtttccgtccacgtgcgaaaggttcagcttcaccaatc
aacaaacgtacaactcacgtaactgtagttgtatcagaaaaataa

DBGET integrated database retrieval system