KEGG   Streptococcus pyogenes A20 (serotype M1): A20_0477Help
Entry
A20_0477          CDS       T02335                                 

Gene name
fadA
Definition
(GenBank) acetyl-CoA acetyltransferases family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Pathway
spya00071  Fatty acid degradation
spya00072  Synthesis and degradation of ketone bodies
spya00280  Valine, leucine and isoleucine degradation
spya00310  Lysine degradation
spya00362  Benzoate degradation
spya00380  Tryptophan metabolism
spya00620  Pyruvate metabolism
spya00630  Glyoxylate and dicarboxylate metabolism
spya00640  Propanoate metabolism
spya00650  Butanoate metabolism
spya00900  Terpenoid backbone biosynthesis
spya01100  Metabolic pathways
spya01110  Biosynthesis of secondary metabolites
spya01120  Microbial metabolism in diverse environments
spya01130  Biosynthesis of antibiotics
spya01200  Carbon metabolism
spya01212  Fatty acid metabolism
spya02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spya00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A20_0477 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    A20_0477 (fadA)
   00640 Propanoate metabolism
    A20_0477 (fadA)
   00650 Butanoate metabolism
    A20_0477 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A20_0477 (fadA)
   00072 Synthesis and degradation of ketone bodies
    A20_0477 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A20_0477 (fadA)
   00310 Lysine degradation
    A20_0477 (fadA)
   00380 Tryptophan metabolism
    A20_0477 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A20_0477 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A20_0477 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A20_0477 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spya04147]
    A20_0477 (fadA)
Enzymes [BR:spya01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A20_0477 (fadA)
Exosome [BR:spya04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A20_0477 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFV37564
Position
423405..424553
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLSGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaacgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgtcaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaaggtcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system