KEGG   Streptococcus pyogenes A20 (serotype M1): A20_0727cHelp
Entry
A20_0727c         CDS       T02335                                 

Gene name
mvaS.1
Definition
(GenBank) hydroxymethylglutaryl-CoA reductase, degradative
  KO
K00054  hydroxymethylglutaryl-CoA reductase [EC:1.1.1.88]
Organism
spya  Streptococcus pyogenes A20 (serotype M1)
Pathway
spya00900  Terpenoid backbone biosynthesis
spya01110  Biosynthesis of secondary metabolites
spya01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spya00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A20_0727c (mvaS.1)
Enzymes [BR:spya01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.88  hydroxymethylglutaryl-CoA reductase
     A20_0727c (mvaS.1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG-CoA_red CAMSAP_CH
Motif
Other DBs
NCBI-ProteinID: AFV37812
Position
complement(687310..688587)
Genome map
AA seq 425 aa AA seqDB search
MTKTNLNWSGFSKKTFEERLQLIEKFKLLNAENLNQLKTDVLLPIQTANQMTENVLGRLA
LPFSIAPDFLVNGSTYQMPFVTEEPSVVAAASFAAKLIKRSGGFKAQTLNRQMIGQIVLY
DIDQIDNAKAAILHKTKKLIALANKAYPSIVKRGGGARTIHLEEKGEFLIFYLTVDTQEA
MGANMVNTMMEALVPDLTRLSKGHCLMAILSNYATESLVTTSCEIPVRLLDHDKTKSLQL
AQKIELASRLAQVDPYRATTHNKGIFNGIDAVVIATGNDWRAIEAGAHAYASRNGSYQGL
SQWHFDQDKQVLLGQMTLPMPIASKGGSIGLNPTVSIAHDLLNQPDAKTLAQLIASVGLA
QNFAALKALTSSGIQAGHMKLHAKSLALLAGATQDEIAPLVNALLADKPINLEKAHFYLS
QLRQS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaactaatcttaactggagcggtttttcaaagaaaacattcgaagaacgcctc
caacttatcgaaaaatttaaactacttaatgctgaaaacttaaatcaactcaaaacagac
gttcttttgcctatccaaacagctaatcaaatgactgaaaatgtcttaggacgattggct
ttgccctttagcatagctcctgattttcttgtcaacggttcaacttatcagatgcctttt
gtcacggaagaaccttctgttgttgctgcagcatctttcgcagcaaaactaatcaaacgc
tcaggtggttttaaagctcaaaccctaaaccgacaaatgattggtcaaattgttctttac
gatatcgaccaaatagataacgctaaagccgccatccttcataaaacaaaaaagctaatt
gcattggcaaataaagcttatccttccattgttaaaagaggtggaggcgctagaaccatt
catttggaagaaaaaggagaatttttgattttctatctgactgttgatacccaagaagct
atgggagcaaatatggtcaatactatgatggaagctcttgttcctgatttaacaagactg
tctaaggggcattgtctaatggcgattttatctaattacgcaacagagtcgcttgttact
actagttgtgagattcccgtgcgccttttagatcacgataaaacaaaatccctacagtta
gctcaaaaaatagagctagccagccgactagctcaagtagatccttaccgggctactact
cataataaaggtatttttaatggcattgatgcagtggtaatagccacaggaaatgactgg
cgtgctattgaagcaggggcccatgcttatgcctcaagaaatggtagctatcaaggactt
agtcagtggcattttgaccaagataaacaagttctgcttggccaaatgaccctccctatg
cctattgctagtaaggggggatctatcgggcttaaccctactgtttctatcgcacatgat
cttcttaatcaacctgatgccaaaacattagcccaattgattgcatctgtggggttagct
caaaactttgctgcactaaaagctctgacctcatctggcatccaagctggtcacatgaaa
ctacatgcgaaatcattagctcttttggcgggggcaacccaagacgaaattgctccttta
gttaatgctttactagctgataaaccaataaatctagaaaaagcacatttttacttatcc
cagctaagacagtcttag

DBGET integrated database retrieval system