KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_00845Help
Entry
L897_00845        CDS       T02743                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Pathway
spyh00071  Fatty acid degradation
spyh00072  Synthesis and degradation of ketone bodies
spyh00280  Valine, leucine and isoleucine degradation
spyh00310  Lysine degradation
spyh00362  Benzoate degradation
spyh00380  Tryptophan metabolism
spyh00620  Pyruvate metabolism
spyh00630  Glyoxylate and dicarboxylate metabolism
spyh00640  Propanoate metabolism
spyh00650  Butanoate metabolism
spyh00900  Terpenoid backbone biosynthesis
spyh01100  Metabolic pathways
spyh01110  Biosynthesis of secondary metabolites
spyh01120  Microbial metabolism in diverse environments
spyh01130  Biosynthesis of antibiotics
spyh01200  Carbon metabolism
spyh01212  Fatty acid metabolism
spyh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    L897_00845
   00630 Glyoxylate and dicarboxylate metabolism
    L897_00845
   00640 Propanoate metabolism
    L897_00845
   00650 Butanoate metabolism
    L897_00845
  09103 Lipid metabolism
   00071 Fatty acid degradation
    L897_00845
   00072 Synthesis and degradation of ketone bodies
    L897_00845
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    L897_00845
   00310 Lysine degradation
    L897_00845
   00380 Tryptophan metabolism
    L897_00845
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    L897_00845
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    L897_00845
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    L897_00845
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spyh04147]
    L897_00845
Enzymes [BR:spyh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     L897_00845
Exosome [BR:spyh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   L897_00845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AGQ27040
Position
134498..135682
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagttggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccagcgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcagcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system