KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_00930Help
Entry
L897_00930        CDS       T02743                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Pathway
spyh00230  Purine metabolism
spyh00250  Alanine, aspartate and glutamate metabolism
spyh01100  Metabolic pathways
Module
spyh_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:spyh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    L897_00930
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    L897_00930
Enzymes [BR:spyh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     L897_00930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AGQ27057
Position
151404..152696
Genome map
AA seq 430 aa AA seqDB search
MTSVVVVGTQWGDEGKGKITDFLSADAEVIARYQGGDNAGHTIVIDGKKFKLHLIPSGIF
FPQKISVIGNGVVVNPKSLVKELGYLHDEGVTTDNLRISDRAHVILPYHIQLDQLQEDAK
GDNKIGTTIKGIGPAYMDKAARVGIRIADLLDKDIFAERLRINLAEKNRLFEKMYDSTPL
DFDAIFEEYYAYGQEIRQYVTDTSVILNDALDAGKRVLFEGAQGVMLDIDQGTYPFVTSS
NPVAGGVTIGSGVGPSKINKVVGVCKAYTSRVGDGPFPTELFDEVGERIREVGHEYGTTT
GRPRRVGWFDSVVMRHSRRVSGITNLSLNSIDVLSGLDTVKICVAYDLDGERIDHYPASL
EQLKRCKPIYEELPGWQEDITGVRSLDELPENARNYVRRVGELVGVRISTFSVGPGREQT
NILESVWASI
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgtagttgttgttggtacccagtggggtgacgaaggtaaaggtaaaatcact
gatttcttgtcagcggatgcagaagtaattgctcgctatcaaggtggtgataatgctggt
catacgatcgtgattgatggtaagaagtttaaacttcacttgatcccatcaggaattttc
ttcccgcaaaaaatttccgttattggtaatggcgttgtggtcaaccccaaatctttggtc
aaagagttggggtacctgcatgatgaaggagtgacgacagataaccttcgcatttcagac
cgagctcatgttattttaccttatcatatccagctggatcaactgcaagaagatgcaaaa
ggtgacaataaaatcggaacaactattaaagggattggtccagcttatatggataaagct
gctcgagttggtatccgtatcgcagatttactggataaggatatttttgcagagcgttta
cgcattaacttagcggagaaaaatcgtctctttgaaaaaatgtacgacagcacaccgctt
gattttgatgctatttttgaagaatactatgcttacggtcaagaaatcagacaatatgtg
acagatacttctgtaattttaaatgatgcacttgatgctgggaaacgtgttctttttgag
ggtgcacaaggggttatgcttgatattgaccaaggaacttacccatttgtaacctcatct
aacccagttgctggtggtgtcactattggttctggggttggcccaagtaaaatcaacaaa
gttgttggtgtctgcaaagcctacactagccgtgttggtgatggcccattcccaacagag
ctttttgatgaagtgggtgaacgtatccgtgaagttggtcatgagtacggtacgacaaca
ggtcgtccacgtcgtgtgggttggtttgactcagttgttatgcgccatagtcgtcgtgta
tcagggattactaacctttctctcaattccattgacgttctttcaggacttgataccgtt
aaaatttgtgttgcttacgacttagatggtgaacgtattgatcactacccagcaagtctc
gagcaactcaaacgttgcaaacctatctacgaagaattgccaggctggcaagaagatatt
acaggtgttcgtagccttgatgagcttcctgaaaatgcccgcaactacgttcgtcgcgtg
ggagaattggttggcgttcgcatttcaaccttctcagttggtccaggacgtgaacagacc
aatattcttgagtcggtctgggcatctatctaa

DBGET integrated database retrieval system