KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_04585Help
Entry
L897_04585        CDS       T02743                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Pathway
spyh00670  One carbon pool by folate
spyh01100  Metabolic pathways
spyh01120  Microbial metabolism in diverse environments
spyh01200  Carbon metabolism
Module
spyh_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:spyh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    L897_04585
Enzymes [BR:spyh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     L897_04585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS CbiA DUF719
Motif
Other DBs
NCBI-ProteinID: AGQ27665
Position
complement(896520..898190)
Genome map
AA seq 556 aa AA seqDB search
MKSDIEIAQSVALQPITDIVKKVGIDGDDIELYGKYKAKLSFEKMKAVEANEPGKLILVT
AINPTPAGEGKSTMSIGLADALNQMGKKTMLALREPSLGPVMGIKGGAAGGGYAQVLPME
DINLHFTGDMHAITTANNALSALIDNHLQQGNDLGIDPRRIIWKRVLDLNDRALRQVIVG
LGSPVNGVPREDGFDITVASEIMAILCLATDLKDLKKRLADIVVAYTYDRKPVYVRDLKV
EGALTLILKDAIKPNLVQTIYGTPALIHGGPFANIAHGCNSVLATSTALRLADYTVTEAG
FGADLGAEKFLNIKVPNLPKAPDAIVIVATLRALKMHGGVAKSDLAAENCEAVRLGFANL
KRHVENMRQFKVPVVVAINEFVADTEAEIATLKALCEEIKVPVELASVWANGAEGGLALA
KTVVRVIDQEAADYKRLYSDEDTLEEKVINIVTQIYGGKAVQFGPKAKTQLKQFAEFGWD
KLPVCMAKTQYSFSDNPSLLGAPTDFDITIREFVPKTGAGFIVGLTGDVMTMPGLPKVPA
AMAMDVAENGTALGLF
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagatatcgaaattgcccaaagtgtcgccttacaaccaatcactgacattgtt
aaaaaggttggaatagacggcgatgacattgagctttatggcaaatataaggctaaattg
tcttttgagaaaatgaaagctgtcgaagctaatgagcctggaaaattaatcttggtaact
gctattaaccctactccagcaggagaaggaaaatcaaccatgtctattggactggcagat
gccttaaatcaaatgggaaaaaaaaccatgcttgccttacgtgaaccctcccttggtcct
gttatggggattaaaggcggggcagcaggtggtggttatgcccaagtattgcctatggaa
gacattaatcttcactttactggtgacatgcatgccattacaaccgctaataatgcatta
tctgctttgattgacaatcatttgcagcaaggaaacgatttaggaattgatcctcgccgc
attatttggaagcgcgtgttggaccttaatgatcgcgctcttcgtcaggtaattgttggc
ttaggtagtccagtgaatggtgtgccacgcgaagatgggtttgatatcacagtagcttct
gaaatcatggcaattttatgtttggcaactgacttaaaagatctaaagaaacgtcttgct
gatatcgtcgtggcttatacctatgatcgtaagcctgtctatgtgcgtgacttgaaggtt
gaaggagcattgacattaattctaaaagatgctatcaagccaaatttggtgcagactatt
tatggaacaccagctcttattcatggggggccatttgctaatattgctcatggttgtaat
tctgtccttgctacctcaacagctttgcgattagcagattacactgttaccgaagcagga
ttcggggccgacctaggagctgaaaaattcctaaatatcaaagtacctaatcttcctaaa
gcaccagatgctattgtcattgttgcaaccttgcgcgcccttaaaatgcatggaggtgtc
gccaaatcagatttagccgctgaaaattgtgaggctgttcgcttaggatttgccaactta
aaacgtcacgtggaaaacatgcgccaattcaaagttccagttgtggtggctatcaatgaa
tttgtagcagataccgaggctgaaattgctaccttaaaagcgctttgtgaagagattaag
gttccagtagaattagccagtgtttgggcaaatggagctgagggaggcttagcattagct
aaaacagtggttcgtgtgattgatcaagaagctgctgactacaaacgtctctattcagat
gaggatactttggaagaaaaagtgatcaatatcgttacccagatttatggtggcaaagct
gttcaatttggccccaaggccaaaacacaattgaagcagttcgcagaattcggttgggat
aaattgcctgtttgtatggctaagacccaatacagtttttcagataacccatccttgctt
ggagcgccaaccgattttgacattaccattcgtgaatttgttcctaaaacaggagcaggt
tttattgttggtttaacaggtgatgtgatgaccatgcctggtttgcctaaagttccagct
gccatggcaatggatgtagcagaaaatggcacagccctcggtctcttttag

DBGET integrated database retrieval system