KEGG   Streptococcus pyogenes HSC5 (serotype M14): L897_06950Help
Entry
L897_06950        CDS       T02743                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
spyh  Streptococcus pyogenes HSC5 (serotype M14)
Pathway
spyh00520  Amino sugar and nucleotide sugar metabolism
spyh01100  Metabolic pathways
spyh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spyh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    L897_06950
Enzymes [BR:spyh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     L897_06950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3 VPS13_C
Motif
Other DBs
NCBI-ProteinID: AGQ28014
Position
complement(1345817..1346965)
Genome map
AA seq 382 aa AA seqDB search
MTCYLKADCFYYPTEVKPAGYLSLHDGVFGEWTEIVPADAQIIDYTGYQIAPGLVDTHIH
GYAGADVMDNSAQGIHQMSEGLLATGVTSFLPTTLTSTFEQLEKVSGTIASVADQVKGAK
IQGIYFEGPYFTEEYKGAQNPSYMKTPRLEEFDAWQKAAKGLIKKIALAPEREGVKEFVS
AVTKQGVTVALGHSNGTYQEAKEAVQAGASVWVHAYNGMRGLTHSEPGMVGAVYNLPNTY
AELICDGHHVSPVACDILMQQKGHDHVAMITDCMRAGGSPDGDYLLGEFSVVVANGTARL
KESGNLAGSILKLKDGLRNVVAWGIATPAEAIHMATYVPAVSVGIDDVCGQIKAGHAADF
IVLDKDLTLVATYLNGQKAFDA
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacatgctatcttaaagcagattgtttttattacccaacagaggtgaaaccggctggc
tacctaagtcttcatgatggtgtttttggggagtggacagaaattgttccggcagatgcg
caaatcattgactacaccggttatcaaattgcaccaggtcttgtggatacgcatatccat
ggctatgcgggagctgatgtcatggataattctgcccaagggattcatcaaatgagtgaa
ggactattagcaacaggagtaacgtcttttttaccgacgaccttaacttctacctttgag
cagttagaaaaagtatcagggactattgcttcagttgctgatcaggtaaaaggtgctaaa
atacaaggtatctactttgaaggtccttattttaccgaagaatataagggtgctcaaaac
ccaagttatatgaaaaccccacgcttggaggaatttgatgcttggcaaaaagctgctaaa
gggctcatcaaaaaaattgcccttgctcctgagcgtgagggtgtcaaagaatttgtgtct
gcagtgacaaaacaaggcgtaacagtggccttagggcattcaaatggtacttatcaagag
gctaaagaagctgttcaagctggtgctagtgtttgggttcatgcttataatggcatgcga
ggattgacccacagtgaaccaggaatggtgggagcggtttataatcttccaaatacttac
gcagagttgatttgtgatggccaccatgtgtcaccagttgcttgtgatattttgatgcag
caaaaagggcatgatcatgtagccatgattacggactgtatgcgagcaggtggttcacca
gatggtgattacctcttgggggaattctctgtggttgtggcaaatggcactgctcgtctt
aaagagagtggaaacttggcaggatctattttgaaattaaaagacggccttagaaatgta
gtggcctggggaatcgcaactccggcagaagccattcatatggcaacttatgtgccagct
gtttctgtcggtattgacgatgtatgtggtcaaatcaaagctgggcatgcggctgacttt
attgttcttgataaggatttaacacttgttgcaacctatttaaatgggcaaaaagctttt
gatgcctaa

DBGET integrated database retrieval system