KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0489Help
Entry
M1GAS476_0489     CDS       T02499                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00071  Fatty acid degradation
spym00072  Synthesis and degradation of ketone bodies
spym00280  Valine, leucine and isoleucine degradation
spym00310  Lysine degradation
spym00362  Benzoate degradation
spym00380  Tryptophan metabolism
spym00620  Pyruvate metabolism
spym00630  Glyoxylate and dicarboxylate metabolism
spym00640  Propanoate metabolism
spym00650  Butanoate metabolism
spym00900  Terpenoid backbone biosynthesis
spym01100  Metabolic pathways
spym01110  Biosynthesis of secondary metabolites
spym01120  Microbial metabolism in diverse environments
spym01130  Biosynthesis of antibiotics
spym01200  Carbon metabolism
spym01212  Fatty acid metabolism
spym02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M1GAS476_0489
   00630 Glyoxylate and dicarboxylate metabolism
    M1GAS476_0489
   00640 Propanoate metabolism
    M1GAS476_0489
   00650 Butanoate metabolism
    M1GAS476_0489
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M1GAS476_0489
   00072 Synthesis and degradation of ketone bodies
    M1GAS476_0489
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M1GAS476_0489
   00310 Lysine degradation
    M1GAS476_0489
   00380 Tryptophan metabolism
    M1GAS476_0489
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M1GAS476_0489
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M1GAS476_0489
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M1GAS476_0489
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spym04147]
    M1GAS476_0489
Enzymes [BR:spym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M1GAS476_0489
Exosome [BR:spym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M1GAS476_0489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAM29823
UniProt: J7M583
Position
1:443483..444631
Genome map
AA seq 382 aa AA seqDB search
MTDVYIAAGLRTPIGLVGKQFAKEQPEILGAKLINALQNKYPVPIDQVICGNTVGTGGNI
GRLMTLYSHLGESVSALTVDMQCASAGAALSVGYAKIKAGMASNLLVGGIESSSLQPESV
YASADWRQGAYKVAQFSPDSISPFAMIEGAERVAREHGFTKEYLNHWTLRSHQKASYCQE
QALLADLILDLSGASDQGIRPRLSSKVLSKVPPILGEGHVISAANACLTHDAAAFLQLSS
QPSAFKLIDVVEVAGDPQRSPLMVIKASQVLLEKHGLGMADMTAIEWNEAFAVIDGLFET
HYPDLLDRYNIFGGALAYGHPYGASAAIIILHLMRALEIKNGRYGIAAIAAAGGQGFAVL
LKYHKEFSHADKARILGKAMPK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgacggatgtttatattgctgcaggccttagaacccctatcggtttagtagggaaacaa
tttgctaaagaacaaccagaaatccttggagcaaagctcatcaacgctttacaaaataag
tatccagttcccattgaccaagtgatttgtggcaataccgtcggaacgggtggtaatatt
gggcgcttgatgaccctgtattctcatttaggagaatctgtctctgctttgacggttgat
atgcagtgtgcatcagctggtgcagctctttccgtgggttatgctaaaatcaaggcaggt
atggcaagcaaccttttagtgggagggattgaaagcagctccttacaacctgaatcggta
tatgcttcagctgattggcgccaaggagcctacaaggtagctcagttttctccagatagt
atcagcccttttgcgatgattgaaggggcagaacgagtggcaagagagcatggctttaca
aaggagtatttgaatcactggacattgagaagtcatcaaaaggctagttattgccaggag
caagccctgttagctgatcttattctagacctgtcaggagccagtgatcaaggtattcga
ccgcgcttgtcaagtaaggtgttgtcaaaggtaccccctatcttaggagaaggtcacgtg
attagtgcagccaatgcctgcctaacccatgatgctgctgcctttttacagctaagtagt
cagccttcagcttttaaactgattgatgtggtagaagtagcaggagacccacagcgtagc
cctttaatggtgattaaggctagtcaagtccttttggaaaaacatggtctagggatggca
gatatgacagcgattgaatggaacgaagcctttgccgttattgatggtctatttgaaacc
cattatccagatttattggaccgctataatatatttggtggtgcattagcttatggtcat
ccctatggtgcctcagcagccattataatattgcacttaatgagggctttagagattaaa
aatggacgctatggaatagctgctatagcagcagctggtggccaagggtttgctgtttta
ctaaaatatcataaggagtttagtcatgctgacaaagctagaatattgggcaaagcaatg
cccaaataa

DBGET integrated database retrieval system