KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0767Help
Entry
M1GAS476_0767     CDS       T02499                                 

Gene name
amiC
Definition
(GenBank) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00330  Arginine and proline metabolism
spym00380  Tryptophan metabolism
spym00627  Aminobenzoate degradation
spym00643  Styrene degradation
spym01100  Metabolic pathways
spym01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spym00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    M1GAS476_0767 (amiC)
   00360 Phenylalanine metabolism
    M1GAS476_0767 (amiC)
   00380 Tryptophan metabolism
    M1GAS476_0767 (amiC)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    M1GAS476_0767 (amiC)
   00643 Styrene degradation
    M1GAS476_0767 (amiC)
Enzymes [BR:spym01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     M1GAS476_0767 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase CHAT
Motif
Other DBs
NCBI-ProteinID: BAM30100
UniProt: J7M7H3
Position
1:726011..727465
Genome map
AA seq 484 aa AA seqDB search
MTYQDATAMAIAVQTGQTTPLELVTQAIYKAKKLNPTLNAITSERFEAALEEAKQRDFSG
LPFAGVPLFLKDLGQELKGHSSTSGSRLFKEYQATKTDLFVKRLEALGFIILGRSNTPEF
GFKNISDSSLHGPVNLPRDNTRNAGGSSGGAAALVSSGISALATASDGGGSIRIPASFNG
LIGLKPSRGRMPVGPGSYRSWQGASVHFALTKSVRDTRNLLYYLQMEQMESPFPLATLTK
DSIYQSLQRPLTIAFYQRLSDGSPVSLDTAKALRQAVTWLREQGHQLVELEEFPVNMTEV
IRHYYIMNSVETAAMFADIEDTFGRPMTKDDMETMTWAIYQSGKDIPAWRYSQVLQKWDT
YSATMASFHETYDLLLTFTTNTPAPKHGELVPDSKLMANLAQAEIFSSEEQFNLVETMFG
KSLAINPYTALPNLTGQPAISLPTYETKEGLSMGIQLIAAKGREDLLLGIAEQFEAAGLL
KIPQ
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcaagatgcgacggctatggctattgctgttcagactggtcagaccacacca
ctagaattagtaacccaggctatttataaggctaaaaagttgaaccctaccttaaatgct
attacctcagaacgctttgaagcagccctagaagaagccaaacaaagggatttttcaggt
ctgccttttgctggtgtgcctctttttttaaaagatttgggacaagaattaaaaggtcac
tcatcaacctcaggttccagattgtttaaagagtatcaagcgactaaaacggatttattt
gtgaaaagattagaagctttaggctttattattttagggcgctccaacacgcctgaattt
ggctttaaaaatattagcgatagcagtttgcacggaccagtgaatttaccaagggataat
acacgaaatgctggtggctcatctgggggagctgctgctctagtgtcatcaggaattagt
gcgctagcaactgctagtgatggtggtggttctattcgaattccagcctcgtttaatggc
ttaattgggctcaaacctagccgtgggcgcatgcctgtcggacctggttcttatcgaagc
tggcaaggagcctcagttcattttgccttgaccaaatccgttagagatactagaaatcta
ctctactatttacagatggaacaaatggaaagccccttccccctagccaccttaacaaaa
gatagtatttatcaatcgctacaacgtcccttgacaattgctttttatcaacggttaagt
gacggtagcccagtatctttagatactgcaaaagctttaagacaagcagtaacttggcta
agagaacaagggcatcagctagttgaattggaagagtttcctgtaaatatgacagaagtg
attcgtcattattatattatgaatagtgtggaaacggctgctatgtttgctgatattgaa
gacacttttggacgtccgatgaccaaagacgatatggaaaccatgacctgggctatttac
caatcaggtaaagacatcccagcttggcgttactcacaggtccttcaaaaatgggatacg
tacagtgcaaccatggctagttttcatgagacttatgacctgttgttgacgttcacaacc
aacacaccagctcctaagcacggagaacttgtcccagattcgaaactcatggctaacttg
gctcaagctgaaattttcagcagtgaagagcaattcaatttggtcgaaaccatgtttggt
aagagtctggctattaatccttacacagctctgcctaatctaactggccagccagctatt
agtttacctacttatgaaactaaggaaggtctctcaatgggcattcaactaattgcagcc
aaaggtagagaggacctattattaggaattgcagaacagtttgaggcagcaggattattg
aagattcctcaataa

DBGET integrated database retrieval system