KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_0950Help
Entry
M1GAS476_0950     CDS       T02499                                 

Gene name
oadA2
Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00620  Pyruvate metabolism
spym01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M1GAS476_0950 (oadA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spym02000]
    M1GAS476_0950 (oadA2)
Enzymes [BR:spym01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     M1GAS476_0950 (oadA2)
Transporters [BR:spym02000]
 Other transporters
  Primary active transporters [TC:3]
   M1GAS476_0950 (oadA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: BAM30280
UniProt: J7M7P0
Position
1:901676..903082
Genome map
AA seq 468 aa AA seqDB search
MIQFGGFSMQQQVAITETVLRDGHQSLMATRLSIEDMLPVLTILDKIGYYSLECWGGATF
DACIRFLNEDPWERLRTLKKGLPNTRLQMLLRGQNLLGYRHYADDIVDKFISLSAQNGID
VFRIFDALNDPRNIQQALRAVKKTGKEAQLCIAYTTSPVHTLNYYLSLVKELVEMGADSI
CIKDMAGILTPKAAKELVSGIKAMTNLPLIVHTHATSGISQMTYLAAVEAGADRIDTALS
PFSEGTSQPATESMYLALKEASYDITLDETLLEQAANHLRQARQKYLADGILDPSLLFPD
PRTLQYQVPGGMLSNMLSQLKQANAESKLEEVLAEVPRVRKDLGYPPLVTPLSQMVGTQA
AMNVILGKPYQMVSKEIKQYLAGDYGKTPAPVNEDLKRSQIGSAPVTTNRPADQLSPEFE
VLKAEVADLAQTDEDVLTYALFPSVAKPFLTTKYQTDDVIKVTAFIKA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
ttgattcagtttggaggttttagcatgcagcagcaagtcgcaataacagaaacagtttta
cgggacggtcatcaaagtttgatggcaacgcgtttatctattgaagatatgcttcctgtc
cttaccatcttagacaagattggttattattccctagagtgttggggaggagcaaccttt
gatgcctgtattcgttttttgaacgaagacccttgggaaaggctgcgcacgttaaaaaaa
ggcttacctaatacccgtttacaaatgttattaagaggccaaaaccttttaggctaccgt
cattatgcagatgacatcgttgacaaattcattagtttatcagctcaaaatgggattgat
gttttccgcatttttgatgccctaaatgacccacgaaatatccagcaagccttaagagct
gtgaaaaagacgggtaaagaggctcaactgtgtattgcctatacaactagcccagtgcac
acgcttaactattacctttctttagtgaaagaattggttgagatgggagctgattctatc
tgcatcaaagatatggctggtattctaactcccaaagcggctaaagagttggtatctggt
atcaaagccatgactaacttacctcttattgtgcatacccatgcaactagtggcatttct
cagatgacctatctagcagcagtagaagctggtgctgatagaattgatacggctttgtca
ccttttagcgaaggcacttcacaacctgctacagaatccatgtatttagccttaaaagaa
gcaagttatgatatcacattagatgaaacgctactggaacaggctgctaatcaccttcga
caagcccgtcaaaagtacttagcagatggcattctggatcccagtcttctctttccagac
ccaaggacactacaataccaagttcctggaggcatgttgtctaatatgctatctcagctg
aaacaagccaatgccgaatcaaaattagaagaagttttagcagaagttcctcgggtaaga
aaagacttgggttatcctcccttagtaacaccgcttagccaaatggtcgggactcaagct
gctatgaatgtgattttaggaaaaccttaccagatggtgtctaaggaaattaaacaatac
ttggcaggcgactatggcaaaacaccagcaccagtcaacgaagacttaaaacgaagtcaa
attggctcagctcctgtcaccacaaatcgtcctgcagatcaactaagtcctgaattcgag
gtgttaaaagcagaagtagcagatttagcccaaacggacgaagatgtgctgacttatgcc
ctcttcccaagcgtagcaaaaccgtttttaacaaccaaataccaaactgatgacgtcatt
aaagtgactgcctttatcaaagcataa

DBGET integrated database retrieval system