KEGG   Streptococcus pyogenes M1 476 (serotype M1): M1GAS476_1422Help
Entry
M1GAS476_1422     CDS       T02499                                 

Gene name
atoB
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spym  Streptococcus pyogenes M1 476 (serotype M1)
Pathway
spym00071  Fatty acid degradation
spym00072  Synthesis and degradation of ketone bodies
spym00280  Valine, leucine and isoleucine degradation
spym00310  Lysine degradation
spym00362  Benzoate degradation
spym00380  Tryptophan metabolism
spym00620  Pyruvate metabolism
spym00630  Glyoxylate and dicarboxylate metabolism
spym00640  Propanoate metabolism
spym00650  Butanoate metabolism
spym00900  Terpenoid backbone biosynthesis
spym01100  Metabolic pathways
spym01110  Biosynthesis of secondary metabolites
spym01120  Microbial metabolism in diverse environments
spym01130  Biosynthesis of antibiotics
spym01200  Carbon metabolism
spym01212  Fatty acid metabolism
spym02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spym00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    M1GAS476_1422 (atoB)
   00630 Glyoxylate and dicarboxylate metabolism
    M1GAS476_1422 (atoB)
   00640 Propanoate metabolism
    M1GAS476_1422 (atoB)
   00650 Butanoate metabolism
    M1GAS476_1422 (atoB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    M1GAS476_1422 (atoB)
   00072 Synthesis and degradation of ketone bodies
    M1GAS476_1422 (atoB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    M1GAS476_1422 (atoB)
   00310 Lysine degradation
    M1GAS476_1422 (atoB)
   00380 Tryptophan metabolism
    M1GAS476_1422 (atoB)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    M1GAS476_1422 (atoB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    M1GAS476_1422 (atoB)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    M1GAS476_1422 (atoB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spym04147]
    M1GAS476_1422 (atoB)
Enzymes [BR:spym01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     M1GAS476_1422 (atoB)
Exosome [BR:spym04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   M1GAS476_1422 (atoB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAM30740
UniProt: J7M8F3
Position
1:1330779..1331966
Genome map
AA seq 395 aa AA seqDB search
MKNIVIVEALRTPIGAFGGSFKSVSAVELGTTVLKKILDKTQVKPEMVDEVILGNVLHAG
LGQNVARQVAVHSGIPEDKTAFTLDMVCGSGLKAIQLAAQSIMLGDADIVIAGGVENMSQ
ATYVSTQHRFGQRLGNSQLIDTLVHDGLTDAFNNYHMGITAENVAQKYGISREEQDQFAL
ESQEKAAKALENHRFADEIVPVSVPQRRKDPLIVTTDEYPKVDTSLEKLQQLRPAFLPKE
GTVTAGNASGINDGAALLMLMTEEKALELGLTPLVTIESYASAGVAPELMGTGPIPATQK
ALKKAGLTISDLDLVESNEAFAAQSLAVLKDLKLNPEIVNVNGGAIALGHPIGASGARIL
VTLIHEMKKRQVTRGLATLCIGGGQGTAVIVKNNT
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacatagttatcgttgaagctttacgaactcctatcggagcttttggaggctcc
tttaaaagtgtctctgctgttgaacttggaacaactgtactgaaaaaaatccttgataaa
acgcaagtaaagcctgaaatggttgatgaagtcatcctaggaaacgtccttcatgcaggc
ctaggacaaaatgtggcaagacaagttgcagtccactcaggaattcctgaagataaaaca
gctttcacattagatatggtttgcggttctggacttaaagcaatccaattagctgcgcaa
agcatcatgcttggtgacgctgatatcgttattgctggtggtgtcgaaaacatgtcacaa
gcaacctatgtatcaactcagcaccgttttggacagcgacttggtaatagtcaattgatt
gatactcttgttcatgatggcttaacagatgcttttaacaattaccacatgggtattact
gctgaaaacgttgctcagaaatatggcatctcaagagaagagcaagatcaatttgcttta
gaaagccaagaaaaagctgctaaagcattagaaaatcatcgttttgctgacgaaattgtc
cctgtctctgtgcctcaacgacgcaaagaccctttaattgttacaacagatgaataccca
aaagttgatacaagccttgaaaaattacagcaattacgtcctgctttcctccctaaagaa
ggaaccgttactgctgggaatgcctcaggaataaacgatggtgcagccttattgatgtta
atgactgaagaaaaagctcttgaattagggttaacacctttagtcactattgaaagctat
gctagtgcaggtgttgcacctgaactgatgggaactggaccaattcctgccactcaaaaa
gcccttaagaaagctggattaacaatttctgatttggacttagtggagtccaatgaagca
tttgcagcacagtccttggcggttttaaaagatttaaagttaaacccagaaatcgtgaat
gttaatggaggagccatcgctttaggtcatcctattggtgccagtggcgctcgcattcta
gtcacattaatccacgaaatgaaaaaacgccaagtaaccagaggactagcaacactttgc
attggtggaggacaaggaactgctgttatcgtgaaaaacaatacttag

DBGET integrated database retrieval system