KEGG   Streptococcus pyogenes STAB901 (serotype M44): STAB901_00870Help
Entry
STAB901_00870     CDS       T03472                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
spyo  Streptococcus pyogenes STAB901 (serotype M44)
Pathway
spyo00071  Fatty acid degradation
spyo00072  Synthesis and degradation of ketone bodies
spyo00280  Valine, leucine and isoleucine degradation
spyo00310  Lysine degradation
spyo00380  Tryptophan metabolism
spyo00620  Pyruvate metabolism
spyo00630  Glyoxylate and dicarboxylate metabolism
spyo00640  Propanoate metabolism
spyo00650  Butanoate metabolism
spyo00900  Terpenoid backbone biosynthesis
spyo01100  Metabolic pathways
spyo01110  Biosynthesis of secondary metabolites
spyo01120  Microbial metabolism in diverse environments
spyo01130  Biosynthesis of antibiotics
spyo01200  Carbon metabolism
spyo01212  Fatty acid metabolism
spyo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    STAB901_00870
   00630 Glyoxylate and dicarboxylate metabolism
    STAB901_00870
   00640 Propanoate metabolism
    STAB901_00870
   00650 Butanoate metabolism
    STAB901_00870
  09103 Lipid metabolism
   00071 Fatty acid degradation
    STAB901_00870
   00072 Synthesis and degradation of ketone bodies
    STAB901_00870
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    STAB901_00870
   00310 Lysine degradation
    STAB901_00870
   00380 Tryptophan metabolism
    STAB901_00870
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    STAB901_00870
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    STAB901_00870
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    STAB901_00870
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:spyo04147]
    STAB901_00870
Enzymes [BR:spyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     STAB901_00870
Exosome [BR:spyo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   STAB901_00870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: AIG49799
Position
134189..135373
Genome map
AA seq 394 aa AA seqDB search
MTKEVVITSAYRTPIGNFGGVFKSLSAVDLGVTVVTKILADTGLKSDAIDEVIFGNVLHA
GLGQNVARQVALNAGLSYDTPAFTIDMVCGSGLKAVELGAQKIQTGNADIVLVGGTENMS
QAPYVLQGQRWGSRMGDSKVVDTMLKDGLSDAFAGYHMGITAENIVQQYGLTREEQDAFA
ADSQRKAQLAIEKGRFKEEIAPVTIPQRKGEPLLVDQDEYPKFGTTVDKLAKLRPAFIKD
EGTVTAGNASGINDGAAAILLMSKEKAEELGLPILAKITSYASAGVDPSIMGCGPIPATK
KALAKAQLTIDDIDLIEANEAFAAQALAVSRDLGFDNEKVNVNGGAIALGHPIGASGARI
LVTLLAEMAKRDVRHGLATLCIGGGQGQSIIVTR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagaagtggtgatcacatctgcttatcgtaccccgataggaaattttggagga
gtctttaaatctttatcagccgtagatttgggggtgacagttgttacaaaaattttagct
gataccggtcttaaaagtgatgccattgatgaagtgatctttgggaatgtgttacatgca
ggtctgggtcaaaatgttgctcggcaagtagcgctaaatgcggggctttcttatgatacc
cctgcttttacgattgatatggtctgtggttctggcttaaaagcagttgagttaggtgct
caaaagattcaaacgggcaacgctgatattgttttagtcggtggtaccgaaaacatgagt
caagcaccttacgttttacaaggccaacgttggggatctcgtatgggagatagtaaagta
gtagataccatgcttaaagatgggttgagtgatgcttttgcaggttatcacatgggtata
acagccgaaaatattgtgcaacagtatggactgaccagagaagaacaagatgcctttgca
gctgatagccaacgtaaagcccaacttgccatagaaaaaggtcgtttcaaagaagagatt
gcacctgtcactattcctcagcgtaaaggtgaacctttactcgttgatcaagatgaatac
cctaaatttggaacgacagtggataagttagcaaagttacgccctgcttttatcaaagat
gaggggacagtaactgctggtaatgcttcaggaatcaatgatggagcagcggcaatttta
ttgatgagtaaagaaaaagctgaagaattagggctccctattttagctaaaatcactagt
tatgcaagtgcaggtgtagacccaagtattatgggctgcggaccaatacctgctacgaaa
aaggctcttgcaaaggctcagctgacaattgatgacattgatttgattgaagcaaacgaa
gcttttgctgctcaggctttagcggtttcacgagaccttggttttgacaatgaaaaagtt
aatgtcaatggaggagctattgctttgggtcacccgattggagcatcaggtgctcgtatt
ttagtcaccttattagcagaaatggctaagcgtgatgtgagacatggcttagcaacgctt
tgtattggtggtggccaaggtcaaagtatcatcgtaacaagatag

DBGET integrated database retrieval system