KEGG   Streptococcus pyogenes MGAS5005 (serotype M1): M5005_Spy0345Help
Entry
M5005_Spy0345     CDS       T00262                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
spz  Streptococcus pyogenes MGAS5005 (serotype M1)
Pathway
spz00450  Selenocompound metabolism
spz00970  Aminoacyl-tRNA biosynthesis
spz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    M5005_Spy0345 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    M5005_Spy0345 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:spz01007]
    M5005_Spy0345 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:spz03016]
    M5005_Spy0345 (metS)
Enzymes [BR:spz01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     M5005_Spy0345 (metS)
Amino acid related enzymes [BR:spz01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   M5005_Spy0345 (metS)
Transfer RNA biogenesis [BR:spz03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    M5005_Spy0345 (metS)
 Prokaryotic type
   Other AARSs
    M5005_Spy0345 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e tRNA-synt_1f Anticodon_1 Imm21
Motif
Other DBs
NCBI-ProteinID: AAZ50963
UniProt: Q9A178
Position
351409..353406
Genome map
AA seq 665 aa AA seqDB search
MKKPFYITTPIYYPSGKLHIGSAYTTIACDVLARYKRLMGHEVFYLTGLDEHGQKIQTKA
KEAGITPQTYVDNMAKDVKALWQLLDISYDTFIRTTDDYHEEVVAAVFEKLLAQDDIYLG
EYSGWYSVSDEEFFTESQLKEVFRDEDGQVIGGIAPSGHEVEWVSEESYFLRLSKYDDRL
VAFFKERPDFIQPDGRMNEMVKNFIEPGLEDLAVSRTTFTWGVPVPSDPKHVVYVWIDAL
LNYATALGYRQANHANFDKFWNGTVFHMVGKDILRFHSIYWPILLMMLDLPMPDRLIAHG
WFVMKDGKMSKSKGNVVYPEMLVERFGLDPLRYYLMRSLPVGSDGTFTPEDYVGRINYEL
ANDLGNLLNRTVAMINKYFDGTVPAYVDNGTAFDADLSQLIDAQLADYHKHMEAVDYPRA
LEAVWTIIARTNKYIDETAPWVLAKEDGDKAQLASVMAHLAASLRLVAHVIQPFMMETSA
AIMAQLGLEPVSDLSTLALADFPANTKVVAKGTPIFPRLDMEAEIDYIKAQMGDSSAISQ
EKEWVPEEVALKSEKDVITFETFDAVEIRVAEVKEVSKVEGSEKLLRFRVDAGDGQDRQI
LSGIAKFYPNEQELVGKKLQIVANLKPRKMMKKYISQGMILSAEHGDQLTVLTVDSSVPN
GSIIG
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccattttacattacgacacccatttattacccatctgggaaattacacatt
ggttctgcctatacaactattgcttgtgatgtcttggcacgctacaagcgcctgatgggc
catgaggtcttttacctcacaggactagatgaacacggacaaaagattcaaaccaaggca
aaagaagctggtattacacctcaaacctacgttgataacatggcaaaggatgtcaaagcc
ctttggcaattgctagatatttcctatgacacatttatccggacaacggacgattaccac
gaagaggtcgttgctgctgtctttgaaaaattgctggcgcaagatgacatttaccttggc
gaatactctggttggtattctgtctctgatgaggaatttttcactgaaagccaattaaaa
gaagtctttagagatgaagacggtcaggttattggagggattgccccatcaggtcatgag
gtcgagtgggtctctgaagaatcctacttcctacgccttagcaaatacgatgatcgtctt
gtggccttctttaaagagcgacctgactttatccaaccagatggtcgtatgaatgaaatg
gtgaaaaactttatcgagccaggcctagaagatttggctgttagccgtactacctttaca
tggggtgtacctgttccatcagacccaaaacacgtggtttatgtctggatcgatgccctc
ttaaactacgcgacagctcttggttatcgtcaagctaatcacgctaactttgataagttt
tggaatggaacggttttccacatggttggaaaagatatcttgcgttttcatagcatctac
tggccaattttactcatgatgcttgatttaccaatgccagaccgcttaattgcccatggt
tggtttgtcatgaaagacggtaaaatgtctaaatcaaaaggcaatgtggtctatccagaa
atgttagttgagcgctttggacttgatcctcttcgttattacctcatgcgttctttgcca
gttggttcagacgggacctttacccctgaagattatgtgggtcgtatcaactatgagtta
gccaacgaccttggcaatttattgaaccgtaccgttgccatgatcaacaagtattttgac
ggcacggtgccagcttatgttgacaatggaactgcctttgatgctgacttaagtcaactg
attgatgctcagctagcagactaccataagcacatggaagcggtggactacccacgcgcc
ttggaggctgtttggaccatcatcgctcgtaccaacaaatacatcgatgaaaccgctcct
tgggtgctcgctaaagaagatggtgacaaagctcaactagccagtgtcatggcacactta
gcagccagcttgcgtctggtcgctcatgtgatccaaccctttatgatggaaacatcagct
gctatcatggcccagcttggtttggaacctgtttctgatttgtcaacacttgctctagca
gattttcctgccaatacaaaggttgttgccaaagggacaccgattttcccacgtcttgac
atggaagctgagattgactacatcaaagcccaaatgggtgacagctcagctatttcccaa
gaaaaagaatgggtccctgaagaggttgcgctcaaatctgaaaaagacgtcatcacattt
gaaacctttgatgctgtggaaatccgtgtggcagaagtcaaggaagtgtcaaaagtggaa
ggttcagaaaaattgctgcgctttagagtagatgcaggagacgggcaagaccgtcaaatc
ttgtcaggtattgccaaattttaccccaacgaacaagaattagtgggtaaaaaactacaa
attgttgctaacctgaaaccgcgtaaaatgatgaaaaaatacatcagtcaagggatgatt
ctatcagcagagcatggagatcagctaacggtcttaaccgttgattcctctgttccaaat
ggaagtatcattggctga

DBGET integrated database retrieval system