KEGG   Serratia quinivorans: E4343_00890Help
Entry
E4343_00890       CDS       T05941                                 

Gene name
dmpG
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
squ  Serratia quinivorans
Pathway
squ00360  Phenylalanine metabolism
squ00362  Benzoate degradation
squ00621  Dioxin degradation
squ00622  Xylene degradation
squ01100  Metabolic pathways
squ01120  Microbial metabolism in diverse environments
squ01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    E4343_00890 (dmpG)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    E4343_00890 (dmpG)
   00622 Xylene degradation
    E4343_00890 (dmpG)
   00621 Dioxin degradation
    E4343_00890 (dmpG)
Enzymes [BR:squ01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     E4343_00890 (dmpG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: QBX64818
Position
188661..189662
Genome map
AA seq 333 aa AA seqDB search
MTILINDSTLRDGQHAVKHQLTAAQLRSYATAADKTGVAMVEVGHGNGLGASSYQVGRAA
LSDEEMLTTVRESLQNSKMGVFMLPGWGTIADLTKALAYGTDVVRIGTHCTEATLAERHL
GWLREQGAEAHAVLMMSHMATPAELAEQAALLVGYGAQAVGIMDSAGSLLPQDVTARITA
MRMQVKVPLIFHAHNNLGMAVANSLAAVQAGAGIIDGCARGFGAGAGNTQLEVLIPVLER
LGFNTGIDLYHFLDAADLAARELMVVPPMIDSLGIVSGLAGVFSGFKSPVLNHAGSAGVD
ARDVFFELGRRQIIAGQEDLIVEVVAELKRAAS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgactattctcattaacgattcaaccctgcgcgatggtcagcatgcggtaaaacaccaa
ctcactgcggcgcagttgcgaagctacgccactgcggcggacaaaaccggtgtggcgatg
gttgaagtcggccacggtaacgggctgggggcttcctcctatcaggtggggcgtgcggca
ttgagtgacgaagagatgctgaccaccgtgcgcgagtctttgcaaaacagcaagatgggg
gtgtttatgttgcccggttggggcaccatcgccgacttgaccaaagctctggcttacggc
acggatgtggtgcgcattggtacccattgtaccgaggctacgctggccgaacgccacctg
ggttggctgcgggaacagggcgctgaggctcatgcggtgctgatgatgagccatatggcc
accccggccgagttggctgagcaggcggcgttactggtgggttacggcgcccaggcggtc
ggcattatggattcggccggcagtcttttgccgcaggatgtcaccgcacgtattacggcc
atgcgcatgcaggtaaaggtgccgctgattttccacgcgcataacaacctgggcatggcg
gtggcgaattcgctggccgccgttcaggcgggcgccggcattattgacggctgcgctcgt
gggtttggtgccggggcgggcaatacccaactggaagtgctgatcccggtattggaacga
ctgggtttcaacaccggcatcgatctctatcattttctggatgccgccgatctcgccgcc
agagagttaatggtggttccgccgatgattgactctctgggcatcgtcagcggtctggcc
ggtgtcttctccggcttcaaaagcccggtgctaaaccatgcaggcagcgccggggtggat
gcgcgcgatgtcttcttcgaactgggacgacgacaaattattgccgggcaggaagacctg
atcgttgaggtcgtcgccgagctgaagagggcggcctcatga

DBGET integrated database retrieval system