KEGG   Serratia quinivorans: E4343_01095Help
Entry
E4343_01095       CDS       T05941                                 

Gene name
cheA
Definition
(GenBank) chemotaxis protein CheA
  KO
K03407  two-component system, chemotaxis family, sensor kinase CheA [EC:2.7.13.3]
Organism
squ  Serratia quinivorans
Pathway
squ02020  Two-component system
squ02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:squ00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    E4343_01095 (cheA)
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    E4343_01095 (cheA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:squ01001]
    E4343_01095 (cheA)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:squ02022]
    E4343_01095 (cheA)
   02035 Bacterial motility proteins [BR:squ02035]
    E4343_01095 (cheA)
Enzymes [BR:squ01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     E4343_01095 (cheA)
Protein kinases [BR:squ01001]
 Histidine kinases
  CheA family [OT]
   E4343_01095 (cheA)
Two-component system [BR:squ02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   E4343_01095 (cheA)
Bacterial motility proteins [BR:squ02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    E4343_01095 (cheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheW CheY-binding Hpt H-kinase_dim HATPase_c
Motif
Other DBs
NCBI-ProteinID: QBX64852
Position
235590..237563
Genome map
AA seq 657 aa AA seqDB search
MSMDISAFYQTFFDEADELLADMEQHLLELDPLAPDIEPLNAIFRAAHSIKGGAATFGFT
VLQETTHLLENLLDGARRQEMSLSTEIINLFLETKDIMQEQLDAYKTSQKPDADSFEYIC
QALRQLALDAQQQDAPAAHPATEHAVAVPAAIEGGMRICLSGLKSSEVPLMLEELGNLGE
VKNPQQTENSLEVTLLTSASEDDISAVLCFVLEPEQISFATPPQAEVAPAAPVQSAPVVA
TAPVVKPAPAAVEVAKPRAKASESTSIRVAVEKVDQLINLVGELVITQSMLAQRSGSLDP
VNHGDLLNSMSQLERNARDLQESVMSIRMMPMEYVFSRFPRLVRDLAGKLNKQVELQLQG
SSTELDKSLIERIIDPLTHLVRNSLDHGIEDPDTRVAAGKSAVGNLILSAEHQGGNICIE
VTDDGAGLNRDKILAKAASQGLAVSDSMSDEDVGMLIFAPGFSTAEQVTDVSGRGVGMDV
VKRNIQEMGGHVEIHSQAGKGTAIRILLPLTLAILDGMSVKVNDEVFILPLNAVMESLQP
QAEDLHPLAGGERVLQVRGEYLPLVELFRVFEVAGAKTDATQGIVVILQSAGRRYALLVD
QLVGQHQVVVKNLESNYRKVPGISAATILGDGSVALIVDVSALQTLNREQRQTDAAA
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatggatattagtgcgttttatcagaccttttttgatgaagcagacgagttgctg
gccgatatggagcaacacctgctggagttggatccgctggcgccggacattgagccgctg
aacgccattttccgcgcagcgcactctataaagggcggggcggctacctttggttttacg
gtactgcaggaaaccacccatctgctggagaacctgctcgatggtgcgcggcgtcaggaa
atgagcctgagcaccgagattatcaacctgtttctggaaaccaaagacattatgcaggag
caactggacgcctataagacgtcacaaaaacctgacgccgacagttttgaatacatctgc
caggcgttgcggcagctggcgttggacgcacagcaacaggatgcccccgcagcgcatccg
gccacggaacatgccgtcgcggtacctgcggcgatcgaaggcgggatgcgaatttgcctg
agtggcctcaaatccagcgaagtcccgctgatgctcgaagagctggggaatctgggcgag
gtgaaaaacccgcagcagaccgaaaacagcctggaagtgacgctgctgacctccgccagc
gaagatgacatcagcgcggtgctctgttttgtgctggagccggagcaaatcagcttcgct
acgccgccgcaggccgaagtcgcgcctgccgcaccggtacagtcagcgcctgtcgtcgcg
acagcaccggtggtcaaaccggcacctgcggctgtcgaagtcgccaaaccacgggccaag
gccagcgaatccaccagtatccgcgtcgcggtagagaaagtggaccagttaattaacctg
gtcggtgagctggtgatcacccaatcgatgctggcgcagcgttcgggcagcctggatccg
gtgaatcacggcgacttgctcaacagcatgagccagttggaacgcaatgcgcgcgatctg
caagagtcggtgatgtcgattcgtatgatgccgatggagtacgtgttcagccgcttcccg
cggttggtacgcgatctggccggcaagttgaataaacaggtggagttgcagctgcagggc
agttcgaccgaactggacaagagcctgatcgaacgcatcatcgaccccttgacccacctg
gtgcgcaacagcctggatcacggcattgaagatcccgatacgcgcgtcgccgccggcaaa
tcggcagtgggtaatctgatcctgtcggcggaacaccagggcggcaatatctgcatcgag
gtgaccgacgacggcgccggtctgaaccgcgataaaattctcgccaaggcggcctcgcag
gggctggcggtcagtgacagcatgagcgatgaagacgttggtatgttgatctttgctccg
ggcttttccactgccgaacaggtcaccgatgtgtccgggcgtggcgtcggcatggacgtg
gtgaagcgaaatattcaggagatgggtgggcatgtagaaatccattctcaggcaggcaag
gggaccgcgatccgcatcctgctgccgttgacgctggcgatcctcgacggtatgtcggtc
aaggtgaacgacgaagtgtttatcctgccgctcaacgcggtgatggaatcactgcagccg
caggccgaagacctgcatccattggccggtggcgagcgagtgttgcaggtgcgcggtgaa
tatctgccgctggtggaactgttccgggtgttcgaagtggcaggcgccaaaaccgatgcc
actcagggcattgtggtgatcctgcaaagtgccggtcgtcgctatgcgttgctggtagat
caattggtcggtcagcatcaggtcgtggtgaagaatctggaaagcaactatcgcaaagtg
ccgggtatttccgccgccactattctcggcgatggcagcgtggcgctgattgtcgatgtc
tcggcgctgcaaacgctgaaccgtgaacagcgtcagaccgacgcggccgcataa

DBGET integrated database retrieval system