KEGG   Serratia quinivorans: E4343_05975Help
Entry
E4343_05975       CDS       T05941                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
squ  Serratia quinivorans
Pathway
squ00620  Pyruvate metabolism
squ00630  Glyoxylate and dicarboxylate metabolism
squ01100  Metabolic pathways
squ01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    E4343_05975 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    E4343_05975 (aldA)
Enzymes [BR:squ01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     E4343_05975 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     E4343_05975 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: QBX65756
Position
1298005..1299444
Genome map
AA seq 479 aa AA seqDB search
MTQNQKRMYINGEFIAHKTGRWIDVINPATEQAIMQIPQGGADEARLAIDAAEAAQPGWE
ALPAVERGRWLHRLAEGIRYREPELTKLIVTEGGKTPELAKVEVLFTADYLDYMAEWARR
YEGEIIQSDRPNENIFLFKKAIGVVVGILPWNFPFFLIARKAAPALVTGNTIVIKPSELT
PGNALLFAEIADQIGLPPGVFNLVTGYGPELGQALAANPKVGMVSLTGSVGAGIATLHAA
ADNVTKVSLELGGKAPAIVMADADLDLAVKAIVSSRIINSGQVCNCTERVYVQREIYPQF
IARLTEAFRQVTFGNPDQQAGLDMGPLISAEAVQRVEDKVTRALSQGATLVMGGKREARS
GYFFPPTLLCDVQQEMEIMHQEIFGPVLPVCCFDSFEQAIAMANDSEYGLTSSVFTSDLN
VAMMAIKQLKFGETYVNRESFEAMQGFHAGWRKSGIGGADGRHGLEDYLQTQVAYLQFR
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaaccaaaaacggatgtatataaacggtgaatttattgctcacaaaactggg
cgctggattgatgtcatcaacccggccaccgaacaagcgatcatgcaaatcccgcaaggg
ggtgcagacgaggccaggctggccattgatgctgccgaagccgcacagccaggctgggaa
gcgctacctgcggttgaacgtggccggtggctacatcgactggccgaaggcatacgctac
agagagccggagctgacgaagttgatcgtcaccgaaggcggtaaaacacctgaattggcc
aaggtagaagtgctgtttactgccgactacctcgactatatggccgagtgggcgcgccgc
tatgagggggagattatccaaagcgaccggccgaatgaaaacatcttcctgttcaaaaaa
gccatcggcgtggtagttggcatcctgccgtggaacttcccgttcttcctgattgcgcgt
aaggccgccccggcgttggtgaccggcaataccatcgtgatcaaacccagtgagctgacg
ccgggcaatgcgttgctgtttgccgaaatcgcggatcagattggcctgccaccgggcgtg
tttaacctggtgaccggctacgggccggagctgggtcaggcactggcggctaacccgaag
gtgggcatggtcagcctgaccggcagcgtcggggccggtatcgccacgctgcacgctgcg
gcagacaacgtcaccaaggtgtcgctggagttgggcggcaaggccccggcaattgtgatg
gccgacgccgatctcgacctggcggtcaaagccatcgtcagctcacgcatcatcaacagt
gggcaggtgtgtaactgcaccgaacgcgtttacgtacagcgggagatttatccgcagttt
attgccaggctgaccgaggctttccgtcaggtcacctttggcaaccctgaccaacaagcc
gggctggatatggggccgttgatcagcgccgaggcggttcaacgagtggaagataaagtg
acgcgggcgctcagccagggcgcaacgttggtgatgggcggcaagcgcgaggcccgcagc
gggtactttttcccacccaccctgctctgcgacgtgcagcaagagatggagatcatgcat
caggaaattttcggcccggtgctgccggtctgttgcttcgacagttttgagcaggcgatc
gctatggctaacgacagcgaatatggcctcacttcgtctgttttcaccagtgacctcaac
gtggcgatgatggcgatcaaacaattaaagttcggcgaaacctacgtcaaccgtgaaagc
tttgaagcgatgcagggtttccatgccggttggcgtaagtccggtattggcggcgccgat
ggccgccacggattggaggattatttgcaaacacaggtcgcctatctgcaattccggtga

DBGET integrated database retrieval system