KEGG   Serratia quinivorans: E4343_13295Help
Entry
E4343_13295       CDS       T05941                                 

Gene name
nadR
Definition
(GenBank) multifunctional transcriptional regulator/nicotinamide-nucleotide adenylyltransferase/ribosylnicotinamide kinase NadR
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
squ  Serratia quinivorans
Pathway
squ00760  Nicotinate and nicotinamide metabolism
squ01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:squ00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    E4343_13295 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:squ03000]
    E4343_13295 (nadR)
Enzymes [BR:squ01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     E4343_13295 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     E4343_13295 (nadR)
Transcription factors [BR:squ03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    E4343_13295 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like Citrate_ly_lig HTH_26 MMR_HSR1 FAD_syn AAA_16 ABC_tran AAA_29 HTH_37 Dynamin_N
Motif
Other DBs
NCBI-ProteinID: QBX67096
Position
complement(2834514..2835773)
Genome map
AA seq 419 aa AA seqDB search
MRQFDYLKASIKQKSCTLQQVADASGMTKGYLSQLLNDKIKSPSAQKLEALHRYLGLEFP
RREKKVGVVFGKFYPLHTGHIYLIQRACSQVDELHVILCHDEPRDRELFENSSMSQQPTV
SDRLRWLLQTFKYQKNIHIHSFDEQGIEPYPHGWNVWSDGVKAFLEQKAIVPSFIYSSEA
QDAPRYREHLGIETVLIDPERSFMNISGRQIRQDPFLYWDYIPTEVKPFFVRTVAILGGE
SSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEMALQYSDYDKIALGQAQYVDFAVK
YANKVAFIDTDFVTTQAFCKKYEGREHPFVQALIDEYRFDLVILLENNTPWVADGLRSLG
NPKDRKVFQHLLEEMLRANNIEYVHVESSDYDERFLRCVELVKQLLAADASRLLGVAAV
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaattcgattacctgaaggcgtcgattaagcagaagagctgcactctgcagcag
gtggcggatgccagtggcatgaccaaaggctatctcagccagttactgaacgacaaaatc
aaaagtccgagcgcccagaaactggaggcgctgcaccgctaccttggcctggaatttcca
cggcgtgagaaaaaggttggcgtggtgtttggtaaattttaccctctgcacaccggccac
atttacctgatccagcgcgcctgcagccaggtagatgagctgcacgtgatcctgtgtcac
gacgaaccccgcgaccgggagctgttcgaaaacagttcaatgtcgcaacagccgacggtc
agcgatcgtctgcgctggctgctgcaaaccttcaagtaccagaaaaacatccatattcat
tccttcgacgaacagggcattgaaccctatccgcatggctggaacgtctggagcgatggg
gtgaaggcttttctggaacagaaagccattgtgccgagctttatctattccagcgaagcg
caggatgccccgcgctaccgtgaacatctggggattgagaccgttctgattgatcccgaa
cgttcatttatgaatatcagcggccgccagatccgtcaggatccgttcctttattgggat
tatattccaaccgaagtgaagccgttctttgttcgtaccgtggcgatcctcggcggtgag
tcgagcggcaaatcgacgctggtgaataagctggcaaacatctttaacaccaccagtgcc
tgggaatatggccgcgactatgtgttctcgcacctcggtggggatgagatggcgctgcag
tattccgactacgacaagattgctcttgggcaggcgcagtacgtcgactttgcggtgaag
tacgccaataaagtggcctttatcgacaccgacttcgtcaccactcaggccttttgtaaa
aagtacgaagggcgagagcacccctttgtgcaggcgctgatcgacgagtaccggtttgat
ctggtgatcctgctggaaaacaacaccccctgggtggcggatggcctgcgcagcctgggt
aaccccaaggatcgcaaagtgttccagcatttgttggaagagatgctgcgggccaataac
atcgagtatgtacacgtggagtccagcgactatgacgaacgcttcctgcgctgcgttgag
ctggttaaacaactgctggcggctgatgccagtcggctgctcggtgttgcggcggtataa

DBGET integrated database retrieval system