KEGG   Serratia quinivorans: E4343_21450Help
Entry
E4343_21450       CDS       T05941                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine(65) synthase TruC
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
squ  Serratia quinivorans
Brite
KEGG Orthology (KO) [BR:squ00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:squ03016]
    E4343_21450 (truC)
Enzymes [BR:squ01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     E4343_21450 (truC)
Transfer RNA biogenesis [BR:squ03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    E4343_21450 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: QBX68575
Position
4577314..4578084
Genome map
AA seq 256 aa AA seqDB search
MLEILYQDEHLVAVNKPSGWLVHRSWLDRHETRFVMQTVRDQIGQHVFTVHRLDRPTSGV
LLMALSSEVARLLSQQFEQHQMQKTYHAVVRGYVLEGATIDYPLTEELDKIADKFASKDK
GPQPAVTHYRPLARVEMPVAIGRYESARYSLVELKPENGRKHQLRRHMVHIRHPIIGDSK
HGDLNQNRGMAQHFGCPRLMLHASHLQLNHPVTGEPLHLSARWDEPWQGVMSQFGWTENL
PELARVEFPPASGQDN
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagattctatatcaggatgagcatttggtggcggtgaacaagccttccgggtgg
ttggtacaccgcagttggctggatcgccatgaaacccggtttgtgatgcaaaccgtgcgc
gatcagattggccagcatgtgtttaccgtgcatcgcctcgatcggcctacctcaggggtg
ctgttgatggcgctgtccagtgaggtggcacggttgctatcgcagcagtttgaacagcat
cagatgcagaaaacctatcatgcggtggtgcgtggttacgtgctggagggtgcgaccatc
gactatccgctgacggaagagctggacaaaatcgccgacaagtttgcctctaaagacaaa
ggcccgcagccggcggtcactcattaccggccgctggcgcgggtagaaatgccggtagcg
attggccgttacgaaagcgcgcgctacagcctggttgaactgaagccggaaaatggccgc
aagcaccagttgcgccgccatatggtgcatatccgccatccgattattggtgacagcaaa
cacggcgacctgaaccagaaccggggtatggcccagcattttggctgtccacgcctgatg
ctgcatgccagtcatctgcaacttaatcatccggtgaccggcgagccgctgcatctttcc
gcgcgctgggatgaaccctggcagggagtcatgtcacagtttggctggacagagaatctc
cctgagcttgccagggttgagtttcccccggctagcggtcaggataactga

DBGET integrated database retrieval system